Recombinant Human HIF1AN protein, His-tagged
Cat.No. : | HIF1AN-3038H |
Product Overview : | Recombinant Human HIF1AN protein(250-349 aa), fused to His tag, was expressed in E. coli. |
Availability | April 30, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 250-349 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | ERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPKRIEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | HIF1AN hypoxia inducible factor 1, alpha subunit inhibitor [ Homo sapiens ] |
Official Symbol | HIF1AN |
Synonyms | HIF1AN; hypoxia inducible factor 1, alpha subunit inhibitor; hypoxia-inducible factor 1-alpha inhibitor; DKFZp762F1811; FIH1; FLJ20615; FLJ22027; Peptide aspartate beta dioxygenase; FIH-1; factor inhibiting HIF1; factor inhibiting HIF-1; peptide-aspartate beta-dioxygenase; hypoxia-inducible factor asparagine hydroxylase; |
Gene ID | 55662 |
mRNA Refseq | NM_017902 |
Protein Refseq | NP_060372 |
MIM | 606615 |
UniProt ID | Q9NWT6 |
◆ Recombinant Proteins | ||
HIF1AN-1402HFL | Recombinant Full Length Human HIF1AN Protein, C-Flag-tagged | +Inquiry |
HIF1AN-5022H | Recombinant Human Hypoxia Inducible Factor 1, Alpha Subunit Inhibitor | +Inquiry |
HIF1AN-4162M | Recombinant Mouse HIF1AN Protein, His (Fc)-Avi-tagged | +Inquiry |
HIF1AN-1069H | Recombinant Human HIF1AN Protein, His (Fc)-Avi-tagged | +Inquiry |
Hif1an-3394M | Recombinant Mouse Hif1an Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HIF1AN-5564HCL | Recombinant Human HIF1AN 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HIF1AN Products
Required fields are marked with *
My Review for All HIF1AN Products
Required fields are marked with *
0
Inquiry Basket