Recombinant Human HIF1AN protein, His-tagged
| Cat.No. : | HIF1AN-3038H |
| Product Overview : | Recombinant Human HIF1AN protein(250-349 aa), fused with N-terminal His tag, was expressed in E.coli. |
| Availability | November 14, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 250-349 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
| AASequence : | ERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPKRIEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | HIF1AN hypoxia inducible factor 1, alpha subunit inhibitor [ Homo sapiens ] |
| Official Symbol | HIF1AN |
| Synonyms | HIF1AN; hypoxia inducible factor 1, alpha subunit inhibitor; hypoxia-inducible factor 1-alpha inhibitor; DKFZp762F1811; FIH1; FLJ20615; FLJ22027; Peptide aspartate beta dioxygenase; FIH-1; factor inhibiting HIF1; factor inhibiting HIF-1; peptide-aspartate beta-dioxygenase; hypoxia-inducible factor asparagine hydroxylase; |
| Gene ID | 55662 |
| mRNA Refseq | NM_017902 |
| Protein Refseq | NP_060372 |
| MIM | 606615 |
| UniProt ID | Q9NWT6 |
| ◆ Recombinant Proteins | ||
| HIF1AN-3467HF | Recombinant Full Length Human HIF1AN Protein, GST-tagged | +Inquiry |
| HIF1AN-1069H | Recombinant Human HIF1AN Protein, His (Fc)-Avi-tagged | +Inquiry |
| HIF1AN-249H | Recombinant Human HIF1AN Protein, MYC/DDK-tagged | +Inquiry |
| HIF1AN-361H | Recombinant Human Hypoxia-Inducible Factor 1, Alpha Subunit Inhibitor | +Inquiry |
| HIF1AN-5022H | Recombinant Human Hypoxia Inducible Factor 1, Alpha Subunit Inhibitor | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| HIF1AN-5564HCL | Recombinant Human HIF1AN 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HIF1AN Products
Required fields are marked with *
My Review for All HIF1AN Products
Required fields are marked with *
