Recombinant Human HIF1AN protein, His-tagged
Cat.No. : | HIF1AN-3353H |
Product Overview : | Recombinant Human HIF1AN protein(Q9NWT6)(2-349aa), fused with C-terminal His tag, was expressed in Yeast. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Yeast |
Tag : | His |
Protein Length : | 2-349aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 41.6 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | AATAAEAVASGSGEPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPKRIEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN |
Gene Name | HIF1AN hypoxia inducible factor 1, alpha subunit inhibitor [ Homo sapiens ] |
Official Symbol | HIF1AN |
Synonyms | HIF1AN; hypoxia inducible factor 1, alpha subunit inhibitor; hypoxia-inducible factor 1-alpha inhibitor; DKFZp762F1811; FIH1; FLJ20615; FLJ22027; Peptide aspartate beta dioxygenase; FIH-1; factor inhibiting HIF1; factor inhibiting HIF-1; peptide-aspartate beta-dioxygenase; hypoxia-inducible factor asparagine hydroxylase; |
Gene ID | 55662 |
mRNA Refseq | NM_017902 |
Protein Refseq | NP_060372 |
MIM | 606615 |
UniProt ID | Q9NWT6 |
◆ Recombinant Proteins | ||
HIF1AN-1069H | Recombinant Human HIF1AN Protein, His (Fc)-Avi-tagged | +Inquiry |
HIF1AN-3467HF | Recombinant Full Length Human HIF1AN Protein, GST-tagged | +Inquiry |
HIF1AN-3560H | Recombinant Human HIF1AN Protein (Ala2-Asn349), His tagged | +Inquiry |
HIF1AN-448H | Recombinant Human HIF1AN Protein, His-tagged | +Inquiry |
HIF1AN-249H | Recombinant Human HIF1AN Protein, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HIF1AN-5564HCL | Recombinant Human HIF1AN 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HIF1AN Products
Required fields are marked with *
My Review for All HIF1AN Products
Required fields are marked with *
0
Inquiry Basket