Recombinant Human HIF1AN protein, His-tagged

Cat.No. : HIF1AN-3353H
Product Overview : Recombinant Human HIF1AN protein(Q9NWT6)(2-349aa), fused with C-terminal His tag, was expressed in Yeast.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Yeast
Tag : His
Protein Length : 2-349aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 41.6 kDa
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
AA Sequence : AATAAEAVASGSGEPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPKRIEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN
Gene Name HIF1AN hypoxia inducible factor 1, alpha subunit inhibitor [ Homo sapiens ]
Official Symbol HIF1AN
Synonyms HIF1AN; hypoxia inducible factor 1, alpha subunit inhibitor; hypoxia-inducible factor 1-alpha inhibitor; DKFZp762F1811; FIH1; FLJ20615; FLJ22027; Peptide aspartate beta dioxygenase; FIH-1; factor inhibiting HIF1; factor inhibiting HIF-1; peptide-aspartate beta-dioxygenase; hypoxia-inducible factor asparagine hydroxylase;
Gene ID 55662
mRNA Refseq NM_017902
Protein Refseq NP_060372
MIM 606615
UniProt ID Q9NWT6

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HIF1AN Products

Required fields are marked with *

My Review for All HIF1AN Products

Required fields are marked with *

0
cart-icon
0
compare icon