Recombinant Human HINT2 protein, GST-tagged
Cat.No. : | HINT2-9755H |
Product Overview : | Recombinant Human HINT2 protein(1-163 aa), fused with N-terminal GST tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-163 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. |
AASequence : | MAAAVVLAAGLRAARRAVAATGVRGGQVRGAAGVTDGNEVAKAQQATPGGAAPTIFSRILDKSLPADILYEDQQCLVFRDVAPQAPVHFLVIPKKPIPRISQAEEEDQQLLGHLLLVAKQTAKAEGLGDGYRLVINDGKLGAQSVYHLHIHVLGGRQLQWPPG |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | HINT2 histidine triad nucleotide binding protein 2 [ Homo sapiens ] |
Official Symbol | HINT2 |
Synonyms | HINT2; histidine triad nucleotide binding protein 2; histidine triad nucleotide-binding protein 2, mitochondrial; HINT-2; HINT-3; HIT-17kDa; PKCI-1-related HIT protein; protein kinase C inhibitor-2; HIT-17; |
Gene ID | 84681 |
mRNA Refseq | NM_032593 |
Protein Refseq | NP_115982 |
MIM | 609997 |
UniProt ID | Q9BX68 |
◆ Recombinant Proteins | ||
Hint2-3397M | Recombinant Mouse Hint2 Protein, Myc/DDK-tagged | +Inquiry |
HINT2-4767H | Recombinant Human HINT2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
HINT2-237H | Recombinant Human HINT2 Protein, MYC/DDK-tagged | +Inquiry |
HINT2-2082R | Recombinant Rhesus monkey HINT2 Protein, His-tagged | +Inquiry |
HINT2-5425Z | Recombinant Zebrafish HINT2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
HINT2-5557HCL | Recombinant Human HINT2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HINT2 Products
Required fields are marked with *
My Review for All HINT2 Products
Required fields are marked with *