Recombinant Human HINT3 Protein, GST-tagged

• Cat.No.: HINT3-4754H
• Product Overview: Human HINT3 full-length ORF ( NP_612638.2, 1 a.a. - 182 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: Histidine triad proteins, such as HINT3, are nucleotide hydrolases and transferases that act on the alpha-phosphate of ribonucleotides (Brenner, 2002 [PubMed 12119013]).[supplied by OMIM
• Molecular Mass: 46.8 kDa
• AA Sequence: MAEEQVNRSAGLAPDCEASATAETTVSSVGTCEAAAKSPEPKDYDSTCVFCRIAGRQDPGTELLHCENEDLICFKDIKPAATHHYLVVPKKHIGNCRTLRKDQVELVENMVTVGKTILERNNFTDFTNVRMGFHMPPFCSISHLHLHVLAPVDQLGFLSKLVYRVNSYWFITADHLIEKLRT
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: HINT3 histidine triad nucleotide binding protein 3 [ Homo sapiens ]
• Official Symbol: HINT3
• Synonyms: HINT4
• Gene ID: 135114
• mRNA Refseq: NM_138571
• Protein Refseq: NP_612638
• MIM: 609998
• UniProt ID: Q9NQE9