Recombinant Human HIPK3 Protein, GST-tagged
Cat.No. : | HIPK3-4765H |
Product Overview : | Human HIPK3 partial ORF ( NP_005725, 1 a.a. - 95 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | HIPK3 (Homeodomain Interacting Protein Kinase 3) is a Protein Coding gene. GO annotations related to this gene include transferase activity, transferring phosphorus-containing groups and protein tyrosine kinase activity. An important paralog of this gene is HIPK2. |
Molecular Mass : | 36.19 kDa |
AA Sequence : | MASQVLVYPPYVYQTQSSAFCSVKKLKVEPSSCVFQERNYPRTYVNGRNFGNSHPPTKGSAFQTKIPFNRPRGHNFSLQTSAVVLKNTAGATKVI |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | HIPK3 homeodomain interacting protein kinase 3 [ Homo sapiens ] |
Official Symbol | HIPK3 |
Synonyms | HIPK3; homeodomain interacting protein kinase 3; homeodomain-interacting protein kinase 3; DYRK6; FIST3; PKY; YAK1; ANPK; FIST; homolog of protein kinase YAK1; fas-interacting serine/threonine-protein kinase; androgen receptor-interacting nuclear protein kinase; |
Gene ID | 10114 |
mRNA Refseq | NM_001048200 |
Protein Refseq | NP_001041665 |
MIM | 604424 |
UniProt ID | Q9H422 |
◆ Recombinant Proteins | ||
HIPK3-4765H | Recombinant Human HIPK3 Protein, GST-tagged | +Inquiry |
Hipk3-1623M | Recombinant Mouse Hipk3 Protein, His-tagged | +Inquiry |
HIPK3-2846R | Recombinant Rat HIPK3 Protein | +Inquiry |
HIPK3-4285C | Recombinant Chicken HIPK3 | +Inquiry |
HIPK3-5428H | Recombinant Human Homeodomain Interacting Protein Kinase 3, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HIPK3 Products
Required fields are marked with *
My Review for All HIPK3 Products
Required fields are marked with *
0
Inquiry Basket