Recombinant Human HIPK3 Protein, GST-tagged

Cat.No. : HIPK3-4765H
Product Overview : Human HIPK3 partial ORF ( NP_005725, 1 a.a. - 95 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : HIPK3 (Homeodomain Interacting Protein Kinase 3) is a Protein Coding gene. GO annotations related to this gene include transferase activity, transferring phosphorus-containing groups and protein tyrosine kinase activity. An important paralog of this gene is HIPK2.
Molecular Mass : 36.19 kDa
AA Sequence : MASQVLVYPPYVYQTQSSAFCSVKKLKVEPSSCVFQERNYPRTYVNGRNFGNSHPPTKGSAFQTKIPFNRPRGHNFSLQTSAVVLKNTAGATKVI
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name HIPK3 homeodomain interacting protein kinase 3 [ Homo sapiens ]
Official Symbol HIPK3
Synonyms HIPK3; homeodomain interacting protein kinase 3; homeodomain-interacting protein kinase 3; DYRK6; FIST3; PKY; YAK1; ANPK; FIST; homolog of protein kinase YAK1; fas-interacting serine/threonine-protein kinase; androgen receptor-interacting nuclear protein kinase;
Gene ID 10114
mRNA Refseq NM_001048200
Protein Refseq NP_001041665
MIM 604424
UniProt ID Q9H422

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HIPK3 Products

Required fields are marked with *

My Review for All HIPK3 Products

Required fields are marked with *

0
cart-icon
0
compare icon