Recombinant Human HIST1H2BH Protein, GST-tagged

Cat.No. : HIST1H2BH-4788H
Product Overview : Human HIST1H2BH full-length ORF (BAG34988.1, 1 a.a. - 126 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Two molecules of each of the four core histones (H2A, H2B, H3, and H4) form an octamer, around which approximately 146 bp of DNA is wrapped in repeating units, called nucleosomes. The linker histone, H1, interacts with linker DNA between nucleosomes and functions in the compaction of chromatin into higher order structures. This gene is intronless and encodes a member of the histone H2B family. Transcripts from this gene lack polyA tails but instead contain a palindromic termination element. This gene is found in the large histone gene cluster on chromosome 6. [provided by RefSeq
Molecular Mass : 40.26 kDa
AA Sequence : MPDPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name HIST1H2BH histone cluster 1 H2B family member h [ Homo sapiens (human) ]
Official Symbol HIST1H2BH
Synonyms HIST1H2BH; histone cluster 1 H2B family member h; H2B/j; H2BFJ; histone H2B type 1-H; H2B histone family, member J; histone 1, H2bh; histone H2B.j; histone cluster 1, H2bh
Gene ID 8345
mRNA Refseq NM_003524
Protein Refseq NP_003515
MIM 602806
UniProt ID Q93079

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HIST1H2BH Products

Required fields are marked with *

My Review for All HIST1H2BH Products

Required fields are marked with *

0

Inquiry Basket

cartIcon