Recombinant Human HIST1H3A protein, His-tagged

Cat.No. : HIST1H3A-3032H
Product Overview : Recombinant Human HIST1H3A protein(P68431)(2-135aa), fused to N-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 2-135aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 19.3 kDa
AA Sequence : ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGER
Purity : Greater than 85% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.
Gene Name HIST1H3A histone cluster 1, H3a [ Homo sapiens ]
Official Symbol HIST1H3A
Synonyms HIST1H3A; histone cluster 1, H3a; H3 histone family, member A , H3FA, histone 1, H3a; histone H3.1; H3/A; histone H3/a; histone H3/b; histone H3/c; histone H3/d; histone H3/f; histone H3/h; histone H3/i; histone H3/j; histone H3/k; histone H3/l; histone 1, H3a; H3 histone family, member A; H3FA;
Gene ID 8350
mRNA Refseq NM_003529
Protein Refseq NP_003520
MIM 602810
UniProt ID P68431

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HIST1H3A Products

Required fields are marked with *

My Review for All HIST1H3A Products

Required fields are marked with *

0

Inquiry Basket

cartIcon