Recombinant Human HIST1H3A protein, His-tagged
Cat.No. : | HIST1H3A-3032H |
Product Overview : | Recombinant Human HIST1H3A protein(P68431)(2-135aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 2-135aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 19.3 kDa |
AA Sequence : | ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGER |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | HIST1H3A histone cluster 1, H3a [ Homo sapiens ] |
Official Symbol | HIST1H3A |
Synonyms | HIST1H3A; histone cluster 1, H3a; H3 histone family, member A , H3FA, histone 1, H3a; histone H3.1; H3/A; histone H3/a; histone H3/b; histone H3/c; histone H3/d; histone H3/f; histone H3/h; histone H3/i; histone H3/j; histone H3/k; histone H3/l; histone 1, H3a; H3 histone family, member A; H3FA; |
Gene ID | 8350 |
mRNA Refseq | NM_003529 |
Protein Refseq | NP_003520 |
MIM | 602810 |
UniProt ID | P68431 |
◆ Recombinant Proteins | ||
HIST1H3A-5064H | Recombinant Human HIST1H3A protein | +Inquiry |
HIST1H3A-3031H | Recombinant Human HIST1H3A protein, GST-tagged | +Inquiry |
HIST1H3A-4301H | Recombinant Human HIST1H3A protein, His-tagged | +Inquiry |
HIST1H3A-7676M | Recombinant Mouse HIST1H3A Protein | +Inquiry |
HIST1H3A-3108H | Recombinant Human Histone Cluster 1, H3a | +Inquiry |
◆ Cell & Tissue Lysates | ||
HIST1H3A-5532HCL | Recombinant Human HIST1H3A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HIST1H3A Products
Required fields are marked with *
My Review for All HIST1H3A Products
Required fields are marked with *