Recombinant Human HIST1H3F Protein, GST-tagged

Cat.No. : HIST1H3F-4798H
Product Overview : Human HIST1H3F full-length ORF (ADR82713.1, 1 a.a. - 136 a.a.) recombinant protein with GST tag at N-terminal.
Availability November 09, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. This structure consists of approximately 146 bp of DNA wrapped around a nucleosome, an octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene is intronless and encodes a member of the histone H3 family. Transcripts from this gene lack polyA tails; instead, they contain a palindromic termination element. This gene is found in the large histone gene cluster on chromosome 6p22-p21.3. [provided by RefSeq
Molecular Mass : 41.4 kDa
AA Sequence : MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name HIST1H3F histone cluster 1 H3 family member f [ Homo sapiens (human) ]
Official Symbol HIST1H3F
Synonyms HIST1H3F; histone cluster 1 H3 family member f; H3/i; H3FI; histone H3.1; H3 histone family, member I; histone 1, H3f; histone H3/I; histone cluster 1, H3f
Gene ID 8968
mRNA Refseq NM_021018
Protein Refseq NP_066298
MIM 602816
UniProt ID P68431

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HIST1H3F Products

Required fields are marked with *

My Review for All HIST1H3F Products

Required fields are marked with *

0
cart-icon
0
compare icon