Recombinant Human HIST1H3F Protein, GST-tagged
| Cat.No. : | HIST1H3F-4798H |
| Product Overview : | Human HIST1H3F full-length ORF (ADR82713.1, 1 a.a. - 136 a.a.) recombinant protein with GST tag at N-terminal. |
| Availability | November 29, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. This structure consists of approximately 146 bp of DNA wrapped around a nucleosome, an octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene is intronless and encodes a member of the histone H3 family. Transcripts from this gene lack polyA tails; instead, they contain a palindromic termination element. This gene is found in the large histone gene cluster on chromosome 6p22-p21.3. [provided by RefSeq |
| Molecular Mass : | 41.4 kDa |
| AA Sequence : | MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | HIST1H3F histone cluster 1 H3 family member f [ Homo sapiens (human) ] |
| Official Symbol | HIST1H3F |
| Synonyms | HIST1H3F; histone cluster 1 H3 family member f; H3/i; H3FI; histone H3.1; H3 histone family, member I; histone 1, H3f; histone H3/I; histone cluster 1, H3f |
| Gene ID | 8968 |
| mRNA Refseq | NM_021018 |
| Protein Refseq | NP_066298 |
| MIM | 602816 |
| UniProt ID | P68431 |
| ◆ Recombinant Proteins | ||
| HIST1H3F-4204M | Recombinant Mouse HIST1H3F Protein, His (Fc)-Avi-tagged | +Inquiry |
| HIST1H3F-3589HF | Recombinant Full Length Human HIST1H3F Protein, GST-tagged | +Inquiry |
| HIST1H3F-7681M | Recombinant Mouse HIST1H3F Protein | +Inquiry |
| HIST1H3F-4798H | Recombinant Human HIST1H3F Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| HIST1H3F-5530HCL | Recombinant Human HIST1H3F 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HIST1H3F Products
Required fields are marked with *
My Review for All HIST1H3F Products
Required fields are marked with *
