Recombinant Human HIST2H2AC Protein, GST-tagged
| Cat.No. : | HIST2H2AC-4809H |
| Product Overview : | Human HIST2H2AC full-length ORF ( NP_003508.1, 1 a.a. - 129 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Two molecules of each of the four core histones (H2A, H2B, H3, and H4) form an octamer, around which approximately 146 bp of DNA is wrapped in repeating units, called nucleosomes. The linker histone, H1, interacts with linker DNA between nucleosomes and functions in the compaction of chromatin into higher order structures. This gene is intronless and encodes a member of the histone H2A family. [provided by RefSeq |
| Molecular Mass : | 40.4 kDa |
| AA Sequence : | MSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYMAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKKTESHKAKSK |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | HIST2H2AC histone cluster 2, H2ac [ Homo sapiens ] |
| Official Symbol | HIST2H2AC |
| Synonyms | H2A; H2A/q; H2AFQ; H2A-GL101 |
| Gene ID | 8338 |
| mRNA Refseq | NM_003517 |
| Protein Refseq | NP_003508 |
| MIM | 602797 |
| UniProt ID | Q16777 |
| ◆ Recombinant Proteins | ||
| HIST2H2AC-1514H | Recombinant Human HIST2H2AC protein, His & GST-tagged | +Inquiry |
| HIST2H2AC-4809H | Recombinant Human HIST2H2AC Protein, GST-tagged | +Inquiry |
| HIST2H2AC-4219M | Recombinant Mouse HIST2H2AC Protein, His (Fc)-Avi-tagged | +Inquiry |
| HIST2H2AC-2241H | Recombinant Human HIST2H2AC Protein, His-tagged | +Inquiry |
| HIST2H2AC-3598HF | Recombinant Full Length Human HIST2H2AC Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| HIST2H2AC-330HCL | Recombinant Human HIST2H2AC lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HIST2H2AC Products
Required fields are marked with *
My Review for All HIST2H2AC Products
Required fields are marked with *
