Recombinant Human HisT4H4, His-tagged
| Cat.No. : | HIST4H4-29325TH |
| Product Overview : | Recombinant full length Human Histone H4 with a proprietary tag; Predicted MWt 37.44 kDa including tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | His |
| Protein Length : | 103 amino acids |
| Description : | Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene is intronless and encodes a member of the histone H4 family. Transcripts from this gene lack polyA tails; instead, they contain a palindromic termination element. |
| Conjugation : | HIS |
| Molecular Weight : | 37.440kDa inclusive of tags |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.31% Glutathione, 0.79% Tris HCl |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG |
| Gene Name | HIST4H4 histone cluster 4, H4 [ Homo sapiens ] |
| Official Symbol | HIST4H4 |
| Synonyms | HIST4H4; histone cluster 4, H4; histone 4, H4; histone H4; MGC24116; |
| Gene ID | 121504 |
| mRNA Refseq | NM_175054 |
| Protein Refseq | NP_778224 |
| Uniprot ID | P62805 |
| Chromosome Location | 12p12.3 |
| Pathway | Amyloids, organism-specific biosystem; Chromosome Maintenance, organism-specific biosystem; Deposition of New CENPA-containing Nucleosomes at the Centromere, organism-specific biosystem; Meiosis, organism-specific biosystem; Meiotic Recombination, organism-specific biosystem; |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HIST4H4 Products
Required fields are marked with *
My Review for All HIST4H4 Products
Required fields are marked with *
