Recombinant Human HisT4H4, His-tagged

Cat.No. : HIST4H4-29325TH
Product Overview : Recombinant full length Human Histone H4 with a proprietary tag; Predicted MWt 37.44 kDa including tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : His
Protein Length : 103 amino acids
Description : Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene is intronless and encodes a member of the histone H4 family. Transcripts from this gene lack polyA tails; instead, they contain a palindromic termination element.
Conjugation : HIS
Molecular Weight : 37.440kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.31% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Gene Name HIST4H4 histone cluster 4, H4 [ Homo sapiens ]
Official Symbol HIST4H4
Synonyms HIST4H4; histone cluster 4, H4; histone 4, H4; histone H4; MGC24116;
Gene ID 121504
mRNA Refseq NM_175054
Protein Refseq NP_778224
Uniprot ID P62805
Chromosome Location 12p12.3
Pathway Amyloids, organism-specific biosystem; Chromosome Maintenance, organism-specific biosystem; Deposition of New CENPA-containing Nucleosomes at the Centromere, organism-specific biosystem; Meiosis, organism-specific biosystem; Meiotic Recombination, organism-specific biosystem;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HIST4H4 Products

Required fields are marked with *

My Review for All HIST4H4 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon