Recombinant Human HKDC1 Protein, GST-tagged

Cat.No. : HKDC1-4828H
Product Overview : Human HKDC1 partial ORF ( NP_079406, 102 a.a. - 200 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a member of the hexokinase protein family. The encoded protein is involved in glucose metabolism, and reduced expression may be associated with gestational diabetes mellitus. High expression of this gene may also be associated with poor prognosis in hepatocarcinoma. [provided by RefSeq, Sep 2016]
Molecular Mass : 36.63 kDa
AA Sequence : KRHVQMESQFYPTPNEIIRGNGIELFEYVADCLADFMKTKDLKHKKLPLGLTFSFPCRQTKLEEGVLLSWTKKFKARGVQDTDVVSRLTKAMRRHKDMD
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name HKDC1 hexokinase domain containing 1 [ Homo sapiens ]
Official Symbol HKDC1
Synonyms HKDC1; hexokinase domain containing 1; FLJ22761; FLJ37767;
Gene ID 80201
UniProt ID Q2TB90

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HKDC1 Products

Required fields are marked with *

My Review for All HKDC1 Products

Required fields are marked with *

0
cart-icon
0
compare icon