Recombinant Human HKDC1 Protein, GST-tagged
Cat.No. : | HKDC1-4828H |
Product Overview : | Human HKDC1 partial ORF ( NP_079406, 102 a.a. - 200 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the hexokinase protein family. The encoded protein is involved in glucose metabolism, and reduced expression may be associated with gestational diabetes mellitus. High expression of this gene may also be associated with poor prognosis in hepatocarcinoma. [provided by RefSeq, Sep 2016] |
Molecular Mass : | 36.63 kDa |
AA Sequence : | KRHVQMESQFYPTPNEIIRGNGIELFEYVADCLADFMKTKDLKHKKLPLGLTFSFPCRQTKLEEGVLLSWTKKFKARGVQDTDVVSRLTKAMRRHKDMD |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | HKDC1 hexokinase domain containing 1 [ Homo sapiens ] |
Official Symbol | HKDC1 |
Synonyms | HKDC1; hexokinase domain containing 1; FLJ22761; FLJ37767; |
Gene ID | 80201 |
UniProt ID | Q2TB90 |
◆ Recombinant Proteins | ||
HKDC1-6544Z | Recombinant Zebrafish HKDC1 | +Inquiry |
Hkdc1-3408M | Recombinant Mouse Hkdc1 Protein, Myc/DDK-tagged | +Inquiry |
HKDC1-1345H | Recombinant Human HKDC1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
HKDC1-4230M | Recombinant Mouse HKDC1 Protein, His (Fc)-Avi-tagged | +Inquiry |
HKDC1-4828H | Recombinant Human HKDC1 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HKDC1-795HCL | Recombinant Human HKDC1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HKDC1 Products
Required fields are marked with *
My Review for All HKDC1 Products
Required fields are marked with *
0
Inquiry Basket