Recombinant Human HKR1 Protein, GST-tagged

Cat.No. : HKR1-4830H
Product Overview : Human HKR1 partial ORF ( NP_861451.1, 191 a.a. - 290 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : HKR1 (HKR1, GLI-Kruppel Zinc Finger Family Member) is a Protein Coding gene. Among its related pathways are Gene Expression. GO annotations related to this gene include nucleic acid binding. An important paralog of this gene is ZNF133.
Molecular Mass : 36.74 kDa
AA Sequence : GTSKALSSPPEEQQPAQSKEDNTVVDIGSSPERRADLEETDKVLHGLEVSGFGEIKYEEFGPGFIKESNLLSLQKTQTGETPYMYTEWGDSFGSMSVLIK
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name HKR1 GLI-Kruppel family member HKR1 [ Homo sapiens ]
Official Symbol HKR1
Synonyms HKR1; GLI-Kruppel family member HKR1; GLI Kruppel family member HKR1; oncogene HKR1; ZNF875;
Gene ID 284459
MIM 165250
UniProt ID P10072

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HKR1 Products

Required fields are marked with *

My Review for All HKR1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon