Recombinant Human HKR1 Protein, GST-tagged
Cat.No. : | HKR1-4830H |
Product Overview : | Human HKR1 partial ORF ( NP_861451.1, 191 a.a. - 290 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | HKR1 (HKR1, GLI-Kruppel Zinc Finger Family Member) is a Protein Coding gene. Among its related pathways are Gene Expression. GO annotations related to this gene include nucleic acid binding. An important paralog of this gene is ZNF133. |
Molecular Mass : | 36.74 kDa |
AA Sequence : | GTSKALSSPPEEQQPAQSKEDNTVVDIGSSPERRADLEETDKVLHGLEVSGFGEIKYEEFGPGFIKESNLLSLQKTQTGETPYMYTEWGDSFGSMSVLIK |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | HKR1 GLI-Kruppel family member HKR1 [ Homo sapiens ] |
Official Symbol | HKR1 |
Synonyms | HKR1; GLI-Kruppel family member HKR1; GLI Kruppel family member HKR1; oncogene HKR1; ZNF875; |
Gene ID | 284459 |
MIM | 165250 |
UniProt ID | P10072 |
◆ Recombinant Proteins | ||
HKR1-4830H | Recombinant Human HKR1 Protein, GST-tagged | +Inquiry |
HKR1-13809H | Recombinant Human HKR1, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HKR1 Products
Required fields are marked with *
My Review for All HKR1 Products
Required fields are marked with *
0
Inquiry Basket