Recombinant Human HKR1 Protein, GST-tagged

• Cat.No.: HKR1-4830H
• Product Overview: Human HKR1 partial ORF ( NP_861451.1, 191 a.a. - 290 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: HKR1 (HKR1, GLI-Kruppel Zinc Finger Family Member) is a Protein Coding gene. Among its related pathways are Gene Expression. GO annotations related to this gene include nucleic acid binding. An important paralog of this gene is ZNF133.
• Molecular Mass: 36.74 kDa
• AA Sequence: GTSKALSSPPEEQQPAQSKEDNTVVDIGSSPERRADLEETDKVLHGLEVSGFGEIKYEEFGPGFIKESNLLSLQKTQTGETPYMYTEWGDSFGSMSVLIK
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: HKR1 GLI-Kruppel family member HKR1 [ Homo sapiens ]
• Official Symbol: HKR1
• Synonyms: HKR1; GLI-Kruppel family member HKR1; GLI Kruppel family member HKR1; oncogene HKR1; ZNF875
• Gene ID: 284459
• MIM: 165250
• UniProt ID: P10072