Recombinant Human HLA-A Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | HLA-A-2390H |
Product Overview : | HLA MS Standard C13 and N15-labeled recombinant protein (NP_002107) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | HLA-A belongs to the HLA class I heavy chain paralogues. This class I molecule is a heterodimer consisting of a heavy chain and a light chain (beta-2 microglobulin). The heavy chain is anchored in the membrane. Class I molecules play a central role in the immune system by presenting peptides derived from the endoplasmic reticulum lumen. They are expressed in nearly all cells. The heavy chain is approximately 45 kDa and its gene contains 8 exons. Exon 1 encodes the leader peptide, exons 2 and 3 encode the alpha1 and alpha2 domains, which both bind the peptide, exon 4 encodes the alpha3 domain, exon 5 encodes the transmembrane region, and exons 6 and 7 encode the cytoplasmic tail. Polymorphisms within exon 2 and exon 3 are responsible for the peptide binding specificity of each class one molecule. Typing for these polymorphisms is routinely done for bone marrow and kidney transplantation. Hundreds of HLA-A alleles have been described. |
Molecular Mass : | 40.8 kDa |
AA Sequence : | MAVMAPRTLLLLLSGALALTQTWAGSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQKMEPRAPWIEQEGPEYWDQETRNMKAHSQTDRANLGTLRGYYNQSEDGSHTIQIMYGCDVGPDGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMAAQITKRKWEAVHAAEQRRVYLEGRCVDGLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWELSSQPTIPIVGIIAGLVLLGAVITGAVVAAVMWRRKSSDRKGGSYTQAASSDSAQGSDVSLTACKVTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | HLA-A major histocompatibility complex, class I, A [ Homo sapiens (human) ] |
Official Symbol | HLA-A |
Synonyms | HLA-A; major histocompatibility complex, class I, A; HLA class I histocompatibility antigen, A-1 alpha chain; antigen presenting molecule; leukocyte antigen class I-A; MHC class I antigen HLA-A heavy chain; HLAA; FLJ26655; |
Gene ID | 3105 |
mRNA Refseq | NM_002116 |
Protein Refseq | NP_002107 |
MIM | 142800 |
UniProt ID | P01891 |
◆ Recombinant Proteins | ||
HLA-A-573HB | Recombinant Human HLA-A*0201 NY-ESO-1 (SLLMWITQC) complex protein, His-Avi-tagged, Biotinylated | +Inquiry |
HLA-A-3557HF | Recombinant Full Length Human HLA-A Protein, GST-tagged | +Inquiry |
HLA-A-2937H | Recombinant Human HLA-A Protein (Full Length), Avi tagged | +Inquiry |
HLA-A-2242H | Recombinant Human HLA-A Protein, His-tagged | +Inquiry |
HLA-A-938H | Recombinant Human HLA-A protein, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HLA-A-5503HCL | Recombinant Human HLA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HLA-A Products
Required fields are marked with *
My Review for All HLA-A Products
Required fields are marked with *
0
Inquiry Basket