Recombinant Human HLA-DOB Protein, GST-tagged

Cat.No. : HLA-DOB-4839H
Product Overview : Human HLA-DOB partial ORF ( NP_002111, 27 a.a. - 116 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Protein Length : 27-116 a.a.
Description : HLA-DOB belongs to the HLA class II beta chain paralogues. This class II molecule is a heterodimer consisting of an alpha (DOA) and a beta chain (DOB), both anchored in the membrane. It is located in intracellular vesicles. DO suppresses peptide loading of MHC class II molecules by inhibiting HLA-DM. Class II molecules are expressed in antigen presenting cells (APC: B lymphocytes, dendritic cells, macrophages). The beta chain is approximately 26-28 kDa and its gene contains 6 exons. Exon one encodes the leader peptide, exons 2 and 3 encode the two extracellular domains, exon 4 encodes the transmembrane domain and exon 5 encodes the cytoplasmic tail. [provided by RefSeq
Molecular Mass : 35.64 kDa
AA Sequence : TDSPEDFVIQAKADCYFTNGTEKVQFVVRFIFNLEEYVRFDSDVGMFVALTKLGQPDAEQWNSRLDLLERSRQAVDGVCRHNYRLGAPFT
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name HLA-DOB major histocompatibility complex, class II, DO beta [ Homo sapiens ]
Official Symbol HLA-DOB
Synonyms HLA-DOB; major histocompatibility complex, class II, DO beta; HLA class II histocompatibility antigen, DO beta chain; MHC class II antigen DOB; DOB; FLJ57033;
Gene ID 3112
mRNA Refseq NM_002120
Protein Refseq NP_002111
MIM 600629
UniProt ID P13765

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HLA-DOB Products

Required fields are marked with *

My Review for All HLA-DOB Products

Required fields are marked with *

0

Inquiry Basket

cartIcon