Recombinant Human HLA-DQA1

Cat.No. : HLA-DQA1-29328TH
Product Overview : Recombinant fragment of Human HLA-DQA1 (aa 24-110) with a N terminal proprietary tag: predicted molecular weight 35.20 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 87 amino acids
Description : HLA-DQA1 belongs to the HLA class II alpha chain paralogues. The class II molecule is a heterodimer consisting of an alpha (DQA) and a beta chain (DQB), both anchored in the membrane. It plays a central role in the immune system by presenting peptides derived from extracellular proteins. Class II molecules are expressed in antigen presenting cells (APC: B Lymphocytes, dendritic cells, macrophages). The alpha chain is approximately 33-35 kDa. It is encoded by 5 exons; exon 1 encodes the leader peptide, exons 2 and 3 encode the two extracellular domains, and exon 4 encodes the transmembrane domain and the cytoplasmic tail. Within the DQ molecule both the alpha chain and the beta chain contain the polymorphisms specifying the peptide binding specificities, resulting in up to four different molecules. Typing for these polymorphisms is routinely done for bone marrow transplantation.
Molecular Weight : 35.200kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : EDIVADHVASCGVNLYQFYGPSGQYTHEFDGDEQFYVDLERKETAWRWPEFSKFGGFDPQGALRNMAVAKHNLNIMIKRYNSTAATN
Sequence Similarities : Belongs to the MHC class II family.Contains 1 Ig-like C1-type (immunoglobulin-like) domain.
Gene Name HLA-DQA1 major histocompatibility complex, class II, DQ alpha 1 [ Homo sapiens ]
Official Symbol HLA-DQA1
Synonyms HLA-DQA1; major histocompatibility complex, class II, DQ alpha 1; HLA DQA; HLA class II histocompatibility antigen, DQ alpha 1 chain; CELIAC1;
Gene ID 3117
mRNA Refseq NM_002122
Protein Refseq NP_002113
MIM 146880
Uniprot ID P01909
Chromosome Location 6p21.3
Pathway Adaptive Immune System, organism-specific biosystem; Allograft rejection, organism-specific biosystem; Allograft rejection, conserved biosystem; Antigen processing and presentation, organism-specific biosystem; Antigen processing and presentation, conserved biosystem;
Function MHC class II receptor activity; MHC class II receptor activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HLA-DQA1 Products

Required fields are marked with *

My Review for All HLA-DQA1 Products

Required fields are marked with *

0
cart-icon