Recombinant Human HLA-DQA1 Protein, GST-tagged
Cat.No. : | HLA-DQA1-4844H |
Product Overview : | Human HLA-DQA1 partial ORF ( NP_002113.2, 24 a.a. - 110 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 24-110 a.a. |
Description : | HLA-DQA1 belongs to the HLA class II alpha chain paralogues. The class II molecule is a heterodimer consisting of an alpha (DQA) and a beta chain (DQB), both anchored in the membrane. It plays a central role in the immune system by presenting peptides derived from extracellular proteins. Class II molecules are expressed in antigen presenting cells (APC: B Lymphocytes, dendritic cells, macrophages). The alpha chain is approximately 33-35 kDa. It is encoded by 5 exons; exon 1 encodes the leader peptide, exons 2 and 3 encode the two extracellular domains, and exon 4 encodes the transmembrane domain and the cytoplasmic tail. Within the DQ molecule both the alpha chain and the beta chain contain the polymorphisms specifying the peptide binding specificities, resulting in up to four different molecules. Typing for these polymorphisms is routinely done for bone marrow transplantation. [provided by RefSeq |
Molecular Mass : | 35.31 kDa |
AA Sequence : | EDIVADHVASCGVNLYQFYGPSGQYTHEFDGDEEFYVDLERKETAWRWPEFSKFGGFDPQGALRNMAVAKHNLNIMIKRYNSTAATN |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | HLA-DQA1 major histocompatibility complex, class II, DQ alpha 1 [ Homo sapiens ] |
Official Symbol | HLA-DQA1 |
Synonyms | HLA-DQA1; major histocompatibility complex, class II, DQ alpha 1; HLA DQA; HLA class II histocompatibility antigen, DQ alpha 1 chain; CELIAC1; HLA-DCA; DC-alpha; DC-1 alpha chain; MHC HLA-DQ alpha; MHC class II DQA1; MHC class II antigen; leucocyte antigen DQA1; MHC class II HLA-DQ-alpha-1; leukocyte antigen alpha chain; MHC class II surface glycoprotein; MHC class II HLA-D alpha glycoprotein; HLA class II histocompatibility antigen, DQ(W3) alpha chain; CD; GSE; DQ-A1; HLA-DQA; FLJ27088; FLJ27328; MGC149527; |
Gene ID | 3117 |
mRNA Refseq | NM_002122 |
Protein Refseq | NP_002113 |
MIM | 146880 |
UniProt ID | P01909 |
◆ Recombinant Proteins | ||
HLA-DQA1-4844H | Recombinant Human HLA-DQA1 Protein, GST-tagged | +Inquiry |
HLA-DQA1-5284H | Recombinant Human HLA-DQA1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
HLA-DQA1-29328TH | Recombinant Human HLA-DQA1 | +Inquiry |
HLA-DQA1-973HFL | Recombinant Full Length Human HLA-DQA1 Protein, C-Flag-tagged | +Inquiry |
HLA-DQA1-1075H | Recombinant Human HLA-DQA1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HLA-DQA1-5507HCL | Recombinant Human HLA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HLA-DQA1 Products
Required fields are marked with *
My Review for All HLA-DQA1 Products
Required fields are marked with *