Recombinant Human HLA-DQA1 protein, His-tagged
Cat.No. : | HLA-DQA1-13815H |
Product Overview : | Recombinant Human HLA-DQA1(24-220 aa) fused with His tag at N-terminal was expressed in E. coli. |
Availability | May 20, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 24-220 aa |
Description : | HLA-DQA1 belongs to the HLA class II alpha chain paralogues. The class II molecule is a heterodimer consisting of an alpha (DQA) and a beta chain (DQB), both anchored in the membrane. It plays a central role in the immune system by presenting peptides derived from extracellular proteins. Class II molecules are expressed in antigen presenting cells (APC: B Lymphocytes, dendritic cells, macrophages). The alpha chain is approximately 33-35 kDa. It is encoded by 5 exons; exon 1 encodes the leader peptide, exons 2 and 3 encode the two extracellular domains, and exon 4 encodes the transmembrane domain and the cytoplasmic tail. Within the DQ molecule both the alpha chain and the beta chain contain the polymorphisms specifying the peptide binding specificities, resulting in up to four different molecules. Typing for these polymorphisms is routinely done for bone marrow transplantation. |
Form : | 1M PBS (58 mM Na2HPO4, 17 mM NaH2PO4, 68 mM NaCl, pH8.0 ), added with 300 mM Imidazole and 0.7% sarcosyl, 15% glycerol. |
AA Sequence : | EDIVADHVASYGVNLYQSYGPSGQYTHEFDGDEQFYVDLGRKETVWCLPVLRQFRFDPQFALTNIAVLKHNLNSL IKRSNSTAATNEVPEVTVFSKSPVTLGQPNILICLVDNIFPPVVNITWLSNGHSVTEGVSETSFLSKSDHSFFKI SYLTLLPSAEESYDCKVEHWGLDKPLLKHWEPEIPAPMSELTETVVC |
Storage : | Aliquot and store at -20 centigrade to -80 centigrade for up to 6 months. Avoid freeze thaw cycles. |
Gene Name | HLA-DQA1 major histocompatibility complex, class II, DQ alpha 1 [ Homo sapiens ] |
Official Symbol | HLA-DQA1 |
Synonyms | HLA-DQA1; major histocompatibility complex, class II, DQ alpha 1; HLA DQA; HLA class II histocompatibility antigen, DQ alpha 1 chain; CELIAC1; HLA-DCA; DC-alpha; DC-1 alpha chain; MHC HLA-DQ alpha; MHC class II DQA1; MHC class II antigen; leucocyte antigen DQA1; MHC class II HLA-DQ-alpha-1; leukocyte antigen alpha chain; MHC class II surface glycoprotein; MHC class II HLA-D alpha glycoprotein; HLA class II histocompatibility antigen, DQ(W3) alpha chain; CD; GSE; DQ-A1; HLA-DQA; FLJ27088; FLJ27328; MGC149527; |
Gene ID | 3117 |
mRNA Refseq | NM_002122 |
Protein Refseq | NP_002113 |
MIM | 146880 |
UniProt ID | P01909 |
Chromosome Location | 6p21.3 |
Pathway | Adaptive Immune System, organism-specific biosystem; Allograft rejection, organism-specific biosystem; Allograft rejection, conserved biosystem; Antigen processing and presentation, organism-specific biosystem; Antigen processing and presentation, conserved biosystem; Asthma, organism-specific biosystem; Asthma, conserved biosystem; |
Function | MHC class II receptor activity; MHC class II receptor activity; |
◆ Recombinant Proteins | ||
HLA-DQA1-13815H | Recombinant Human HLA-DQA1 protein, His-tagged | +Inquiry |
HLA-DQA1-1075H | Recombinant Human HLA-DQA1 Protein, His (Fc)-Avi-tagged | +Inquiry |
HLA-DQA1-4844H | Recombinant Human HLA-DQA1 Protein, GST-tagged | +Inquiry |
HLA-DQA1-5284H | Recombinant Human HLA-DQA1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
HLA-DQA1-5291H | Recombinant Human HLA-DQA1 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HLA-DQA1-5507HCL | Recombinant Human HLA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HLA-DQA1 Products
Required fields are marked with *
My Review for All HLA-DQA1 Products
Required fields are marked with *
0
Inquiry Basket