"HLA-DQA1" Related Products

Expand

Recombinant Human HLA-DQA1 protein, His-tagged

Cat.No.: HLA-DQA1-13815H
Product Overview: Recombinant Human HLA-DQA1(24-220 aa) fused with His tag at N-terminal was expressed in E. coli.
Description: HLA-DQA1 belongs to the HLA class II alpha chain paralogues. The class II molecule is a heterodimer consisting of an alpha (DQA) and a beta chain (DQB), both anchored in the membrane. It plays a central role in the immune system by presenting peptides derived from extracellular proteins. Class II molecules are expressed in antigen presenting cells (APC: B Lymphocytes, dendritic cells, macrophages). The alpha chain is approximately 33-35 kDa. It is encoded by 5 exons; exon 1 encodes the leader peptide, exons 2 and 3 encode the two extracellular domains, and exon 4 encodes the transmembrane domain and the cytoplasmic tail. Within the DQ molecule both the alpha chain and the beta chain contain the polymorphisms specifying the peptide binding specificities, resulting in up to four different molecules. Typing for these polymorphisms is routinely done for bone marrow transplantation.
Source: E. coli
Species: Human
Tag: His
Form: 1M PBS (58 mM Na2HPO4, 17 mM NaH2PO4, 68 mM NaCl, pH8.0 ), added with 300 mM Imidazole and 0.7% sarcosyl, 15% glycerol.
Protein length: 24-220 aa
AA Sequence: EDIVADHVASYGVNLYQSYGPSGQYTHEFDGDEQFYVDLGRKETVWCLPVLRQFRFDPQFALTNIAVLKHNLNSL IKRSNSTAATNEVPEVTVFSKSPVTLGQPNILICLVDNIFPPVVNITWLSNGHSVTEGVSETSFLSKSDHSFFKI SYLTLLPSAEESYDCKVEHWGLDKPLLKHWEPEIPAPMSELTETVVC
Storage: Aliquot and store at -20 centigrade to -80 centigrade for up to 6 months. Avoid freeze thaw cycles.
Gene Name: HLA-DQA1 major histocompatibility complex, class II, DQ alpha 1 [ Homo sapiens ]
Official Symbol: HLA-DQA1
Synonyms: HLA-DQA1; major histocompatibility complex, class II, DQ alpha 1; HLA DQA; HLA class II histocompatibility antigen, DQ alpha 1 chain; CELIAC1; HLA-DCA; DC-alpha; DC-1 alpha chain; MHC HLA-DQ alpha; MHC class II DQA1; MHC class II antigen; leucocyte antigen DQA1; MHC class II HLA-DQ-alpha-1; leukocyte antigen alpha chain; MHC class II surface glycoprotein; MHC class II HLA-D alpha glycoprotein; HLA class II histocompatibility antigen, DQ(W3) alpha chain; CD; GSE; DQ-A1; HLA-DQA; FLJ27088; FLJ27328; MGC149527;
Gene ID: 3117
mRNA Refseq: NM_002122
Protein Refseq: NP_002113
MIM: 146880
UniProt ID: P01909
Chromosome Location: 6p21.3
Pathway: Adaptive Immune System, organism-specific biosystem; Allograft rejection, organism-specific biosystem; Allograft rejection, conserved biosystem; Antigen processing and presentation, organism-specific biosystem; Antigen processing and presentation, conserved biosystem; Asthma, organism-specific biosystem; Asthma, conserved biosystem;
Function: MHC class II receptor activity; MHC class II receptor activity;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.