Recombinant Human HLA-DRB1 Protein, His-SUMO/MYC-tagged

Cat.No. : HLA-DRB1-1240H
Product Overview : Recombinant Human HLA-DRB1 Protein (30-227aa) was expressed in E. coli with N-terminal His-SUMO and C-terminal MYC-tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&Myc&SUMO
Protein Length : 30-227 a.a.
Form : Tris-based buffer, 50% glycerol.
Molecular Mass : 42.9 kDa
AA Sequence : GDTRPRFLWQLKFECHFFNGTERVRLLERCIYNQEESVRFDSDVGEYRAVTELGRPDAEYWNSQKDLLEQ
RRAAVDTYCRHNYGVGESFTVQRRVEPKVTVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFRNGQEEKA
GVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRARSESAQSK
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Gene Name HLA-DRB1 major histocompatibility complex, class II, DR beta 1 [ Homo sapiens ]
Official Symbol HLA-DRB1 major histocompatibility complex, class II, DR beta 1 [ Homo sapiens ]
Synonyms HLA-DRB1; major histocompatibility complex, class II, DR beta 1; HLA DR1B; DW2.2/DR2.2; MHC class II antigen; lymphocyte antigen DRB1; MHC class II HLA-DRw10-beta; human leucocyte antigen DRB1; MHC class II HLA-DR beta 1 chain; MHC class II HLA-DR-beta cell surface glycoprotein; HLA class II histocompatibility antigen, DR-1 beta chain; SS1; DRB1; DRw10; HLA-DRB; HLA-DR1B; FLJ75017; FLJ76359
Gene ID 3123
mRNA Refseq NM_001243965
Protein Refseq NP_001230894
MIM 142857
UniProt ID P01911

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HLA-DRB1 Products

Required fields are marked with *

My Review for All HLA-DRB1 Products

Required fields are marked with *

0
cart-icon