Recombinant Human HLA-E protein, His-SUMO-tagged

Cat.No. : HLA-E-3872H
Product Overview : Recombinant Human HLA-E protein(P13747)(22-305aa), fused to N-terminal His-SUMO tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&SUMO
Protein Length : 22-305aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 48.7 kDa
AA Sequence : GSHSLKYFHTSVSRPGRGEPRFISVGYVDDTQFVRFDNDAASPRMVPRAPWMEQEGSEYWDRETRSARDTAQIFRVNLRTLRGYYNQSEAGSHTLQWMHGCELGPDRRFLRGYEQFAYDGKDYLTLNEDLRSWTAVDTAAQISEQKSNDASEAEHQRAYLEDTCVEWLHKYLEKGKETLLHLEPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQQDGEGHTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPVTLRWKPASQPTIPI
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.
Gene Name HLA-E major histocompatibility complex, class I, E [ Homo sapiens ]
Official Symbol HLA-E
Synonyms HLA-E; major histocompatibility complex, class I, E; HLA class I histocompatibility antigen, alpha chain E; MHC HLA-E alpha-1; lymphocyte antigen; MHC HLA-E alpha-2.1; MHC class I antigen E; HLA class I histocompatibility antigen, E alpha chain; MHC; QA1; EA1.2; EA2.1; HLA-6.2; DKFZp686P19218;
Gene ID 3133
mRNA Refseq NM_005516
Protein Refseq NP_005507
MIM 143010
UniProt ID P13747

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HLA-E Products

Required fields are marked with *

My Review for All HLA-E Products

Required fields are marked with *

0

Inquiry Basket

cartIcon