Recombinant Human HLA-E protein, His-SUMO-tagged
Cat.No. : | HLA-E-3872H |
Product Overview : | Recombinant Human HLA-E protein(P13747)(22-305aa), fused to N-terminal His-SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 22-305aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 48.7 kDa |
AA Sequence : | GSHSLKYFHTSVSRPGRGEPRFISVGYVDDTQFVRFDNDAASPRMVPRAPWMEQEGSEYWDRETRSARDTAQIFRVNLRTLRGYYNQSEAGSHTLQWMHGCELGPDRRFLRGYEQFAYDGKDYLTLNEDLRSWTAVDTAAQISEQKSNDASEAEHQRAYLEDTCVEWLHKYLEKGKETLLHLEPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQQDGEGHTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPVTLRWKPASQPTIPI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | HLA-E major histocompatibility complex, class I, E [ Homo sapiens ] |
Official Symbol | HLA-E |
Synonyms | HLA-E; major histocompatibility complex, class I, E; HLA class I histocompatibility antigen, alpha chain E; MHC HLA-E alpha-1; lymphocyte antigen; MHC HLA-E alpha-2.1; MHC class I antigen E; HLA class I histocompatibility antigen, E alpha chain; MHC; QA1; EA1.2; EA2.1; HLA-6.2; DKFZp686P19218; |
Gene ID | 3133 |
mRNA Refseq | NM_005516 |
Protein Refseq | NP_005507 |
MIM | 143010 |
UniProt ID | P13747 |
◆ Recombinant Proteins | ||
HLA-E-2276H | Recombinant Human HLA-E protein, His&Myc-tagged | +Inquiry |
HLA-E-040HP | Recombinant Human HLA-E complex Protein (tetramer), His-Avi-tagged, PE-Labeled | +Inquiry |
HLA-E-268HFL | Recombinant Full Length Human HLA-E Protein, C-Flag-tagged | +Inquiry |
HLA-E-1076H | Recombinant Human HLA-E Protein, His (Fc)-Avi-tagged | +Inquiry |
HLA-E-038H | Recombinant Human HLA-E protein, His-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HLA-E-800HCL | Recombinant Human HLA-E cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HLA-E Products
Required fields are marked with *
My Review for All HLA-E Products
Required fields are marked with *