Recombinant Human HLA-F protein, His-tagged
| Cat.No. : | HLA-F-3439H |
| Product Overview : | Recombinant Human HLA-F protein(21-298 aa), fused to His tag, was expressed in E. coli. |
| Availability | June 05, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 21-298 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | AGSHSLRYFSTAVSRPGRGEPRYIAVEYVDDTQFLRFDSDAAIPRMEPREPWVEQEGPQYWEWTTGYAKANAQTDRVALRNLLRRYNQSEAGSHTLQGMNGCDMGPDGRLLRGYHQHAYDGKDYISLNEDLRSWTAADTVAQITQRFYEAEEYAEEFRTYLEGECLELLRRYLENGKETLQRADPPKAHVAHHPISDHEATLRCWALGFYPAEITLTWQRDGEEQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPQPLILRWEQS |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | HLA-F major histocompatibility complex, class I, F [ Homo sapiens ] |
| Official Symbol | HLA-F |
| Synonyms | HLA-F; major histocompatibility complex, class I, F; HLA class I histocompatibility antigen, alpha chain F; HLA F antigen; leukocyte antigen F; HLA class I molecule; MHC class Ib antigen; MHC class I antigen F; HLAF; CDA12; HLA-5.4; HLA-CDA12; |
| Gene ID | 3134 |
| mRNA Refseq | NM_001098478 |
| Protein Refseq | NP_001091948 |
| MIM | 143110 |
| UniProt ID | P30511 |
| ◆ Recombinant Proteins | ||
| HLA-F-239H | Recombinant Human HLA-F, His-tagged | +Inquiry |
| HLA-F-3439H | Recombinant Human HLA-F protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| HLA-F-331HCL | Recombinant Human HLA-F lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HLA-F Products
Required fields are marked with *
My Review for All HLA-F Products
Required fields are marked with *
