Recombinant Human HLA-G protein, His-B2M-tagged
Cat.No. : | HLA-G-4305H |
Product Overview : | Recombinant Human HLA-G protein(P17693)(25-308aa), fused to N-terminal His tag and B2M tag, was expressed in E. coli. |
Availability | June 11, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | B2M&His |
Protein Length : | 25-308aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 47.2 kDa |
AA Sequence : | GSHSMRYFSAAVSRPGRGEPRFIAMGYVDDTQFVRFDSDSACPRMEPRAPWVEQEGPEYWEEETRNTKAHAQTDRMNLQTLRGYYNQSEASSHTLQWMIGCDLGSDGRLLRGYEQYAYDGKDYLALNEDLRSWTAADTAAQISKRKCEAANVAEQRRAYLEGTCVEWLHRYLENGKEMLQRADPPKTHVTHHPVFDYEATLRCWALGFYPAEIILTWQRDGEDQTQDVELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLMLRWKQSSLPTIPI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
Publications : |
BiTE-Secreting CAR-γδT as a Dual Targeting Strategy for the Treatment of Solid Tumors (2023)
Targeting Dual Immune Checkpoints PD-L1 and HLA-G by Trispecific T Cell Engager for Treating Heterogeneous Lung Cancer (2024)
|
Gene Name | HLA-G major histocompatibility complex, class I, G [ Homo sapiens ] |
Official Symbol | HLA-G |
Synonyms | HLA-G; major histocompatibility complex, class I, G; HLA G histocompatibility antigen, class I, G; HLA class I histocompatibility antigen, alpha chain G; b2 microglobulin; HLA G antigen; HLA class I molecule; MHC class I antigen G; HLA-G histocompatibility antigen, class I, G; MHC-G; |
Gene ID | 3135 |
mRNA Refseq | NM_002127 |
Protein Refseq | NP_002118 |
MIM | 142871 |
UniProt ID | P17693 |
◆ Recombinant Proteins | ||
HLA-G-5426H | Recombinant Human HLA-G protein | +Inquiry |
HLA-G-3075H | Recombinant Human HLA-G Protein (Met29-His117), N-GST tagged | +Inquiry |
HLA-G-503C | Recombinant Cynomolgus HLA-G protein, His-Avi-tagged | +Inquiry |
HLA-G-1718HFL | Recombinant Full Length Human HLA-G Protein, C-Flag-tagged | +Inquiry |
HLA-G-033H | Recombinant Human HLA-G Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
HLA-G-1242H | Recombinant Human HLA-G & B2M Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HLA-G-5493HCL | Recombinant Human HLA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HLA-G Products
Required fields are marked with *
My Review for All HLA-G Products
Required fields are marked with *
0
Inquiry Basket