Recombinant Human HMBOX1 Protein, GST-tagged

Cat.No. : HMBOX1-4268H
Product Overview : Human FLJ21616 full-length ORF ( NP_078843.2, 1 a.a. - 420 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : HMBOX1 (Homeobox Containing 1) is a Protein Coding gene. An important paralog of this gene is HNF1B.
Molecular Mass : 73.7 kDa
AA Sequence : MLSSFPVVLLETMSHYTDEPRFTIEQIDLLQRLRRTGMTKHEILHALETLDRLDQEHSDKFGRRSSYGGSSYGNSTNNVPASSSTATASTQTQHSGMSPSPSNSYDTSPQPCTTNQNGRENNERLSTSNGKMSPTRYHANSMGQRSYSFEASEEDLDVDDKVEELMRRDSSVIKEEIKAFLANRRISQAVVAQVTGISQSRISHWLLQQGSDLSEQKKRAFYRWYQLEKTNPGATLSMRPAPIPIEDPEWRQTPPPVSATSGTFRLRRGSRFTWRKECLAVMESYFNENQYPDEAKREEIANACNAVIQKPGKKLSDLERVTSLKVYNWFANRRKEIKRRANIEAAILESHGIDVQSPGGHSNSDDVDGNDYSEQDDSTSHSDHQDPISLAVEMAAVNHTILALARQGANEIKTEALDDD
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name HMBOX1 homeobox containing 1 [ Homo sapiens ]
Official Symbol HMBOX1
Synonyms HMBOX1; homeobox containing 1; homeobox-containing protein 1; FLJ21616; HNF1LA; PBHNF; homeobox-containing protein PBHNF;
Gene ID 79618
mRNA Refseq NM_001135726
Protein Refseq NP_001129198
UniProt ID Q6NT76

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HMBOX1 Products

Required fields are marked with *

My Review for All HMBOX1 Products

Required fields are marked with *

0
cart-icon