Recombinant Full Length Human HMBOX1 Protein, GST-tagged
| Cat.No. : | HMBOX1-4911HF |
| Product Overview : | Human FLJ21616 full-length ORF ( NP_078843.2, 1 a.a. - 420 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 420 amino acids |
| Description : | HMBOX1 (Homeobox Containing 1) is a Protein Coding gene. An important paralog of this gene is HNF1B. |
| Molecular Mass : | 73.7 kDa |
| AA Sequence : | MLSSFPVVLLETMSHYTDEPRFTIEQIDLLQRLRRTGMTKHEILHALETLDRLDQEHSDKFGRRSSYGGSSYGNSTNNVPASSSTATASTQTQHSGMSPSPSNSYDTSPQPCTTNQNGRENNERLSTSNGKMSPTRYHANSMGQRSYSFEASEEDLDVDDKVEELMRRDSSVIKEEIKAFLANRRISQAVVAQVTGISQSRISHWLLQQGSDLSEQKKRAFYRWYQLEKTNPGATLSMRPAPIPIEDPEWRQTPPPVSATSGTFRLRRGSRFTWRKECLAVMESYFNENQYPDEAKREEIANACNAVIQKPGKKLSDLERVTSLKVYNWFANRRKEIKRRANIEAAILESHGIDVQSPGGHSNSDDVDGNDYSEQDDSTSHSDHQDPISLAVEMAAVNHTILALARQGANEIKTEALDDD |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | HMBOX1 homeobox containing 1 [ Homo sapiens ] |
| Official Symbol | HMBOX1 |
| Synonyms | HMBOX1; homeobox containing 1; homeobox-containing protein 1; FLJ21616; HNF1LA; PBHNF; homeobox-containing protein PBHNF; |
| Gene ID | 79618 |
| mRNA Refseq | NM_001135726 |
| Protein Refseq | NP_001129198 |
| MIM | 618610 |
| UniProt ID | Q6NT76 |
| ◆ Recombinant Proteins | ||
| HMBOX1-4268H | Recombinant Human HMBOX1 Protein, GST-tagged | +Inquiry |
| HMBOX1-1536H | Recombinant Human HMBOX1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| HMBOX1-13834H | Recombinant Human HMBOX1, His-tagged | +Inquiry |
| HMBOX1-7720M | Recombinant Mouse HMBOX1 Protein | +Inquiry |
| HMBOX1-5088C | Recombinant Chicken HMBOX1 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| HMBOX1-5485HCL | Recombinant Human HMBOX1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HMBOX1 Products
Required fields are marked with *
My Review for All HMBOX1 Products
Required fields are marked with *
