Recombinant Human HMBS Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | HMBS-6081H |
Product Overview : | HMBS MS Standard C13 and N15-labeled recombinant protein (NP_001019553) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a member of the hydroxymethylbilane synthase superfamily. The encoded protein is the third enzyme of the heme biosynthetic pathway and catalyzes the head to tail condensation of four porphobilinogen molecules into the linear hydroxymethylbilane. Mutations in this gene are associated with the autosomal dominant disease acute intermittent porphyria. Alternatively spliced transcript variants encoding different isoforms have been described. |
Molecular Mass : | 37.5 kDa |
AA Sequence : | MRVIRVGTRKSQLARIQTDSVVATLKASYPGLQFEIIAMSTTGDKILDTALSKIGEKSLFTKELEHALEKNEVDLVVHSLKDLPTVLPPGFTIGAICKRENPHDAVVFHPKFVGKTLETLPEKSVVGTSSLRRAAQLQRKFPHLEFRSIRGNLNTRLRKLDEQQEFSAIILATAGLQRMGWHNRVGQILHPEECMYAVGQGALGVEVRAKDQDILDLVGVLHDPETLLRCIAERAFLRHLEGGCSVPVAVHTAMKDGQLYLTGGVWSLDGSDSIQETMQATIHVPAQHEDGPEDDPQLVGITARNIPRGPQLAAQNLGISLANLLLSKGAKNILDVARQLNDAHTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | HMBS hydroxymethylbilane synthase [ Homo sapiens (human) ] |
Official Symbol | HMBS |
Synonyms | HMBS; hydroxymethylbilane synthase; PBGD, PORC, porphobilinogen deaminase, porphyria, acute; Chester type, UPS, uroporphyrinogen I synthase; porphobilinogen deaminase; uroporphyrinogen I synthase; pre-uroporphyrinogen synthase; uroporphyrinogen I synthetase; porphyria, acute; Chester type; UPS; PBGD; PORC; PBG-D; |
Gene ID | 3145 |
mRNA Refseq | NM_001024382 |
Protein Refseq | NP_001019553 |
MIM | 609806 |
UniProt ID | P08397 |
◆ Recombinant Proteins | ||
HMBS-1078H | Recombinant Human HMBS Protein, His (Fc)-Avi-tagged | +Inquiry |
HMBS-3636HF | Recombinant Full Length Human HMBS Protein, GST-tagged | +Inquiry |
HMBS-237HF | Recombinant Full Length Human HMBS Protein | +Inquiry |
HMBS-2031H | Recombinant Human HMBS Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
HMBS-1374HFL | Recombinant Full Length Human HMBS Protein, C-Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HMBS-5483HCL | Recombinant Human HMBS 293 Cell Lysate | +Inquiry |
HMBS-5484HCL | Recombinant Human HMBS 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HMBS Products
Required fields are marked with *
My Review for All HMBS Products
Required fields are marked with *
0
Inquiry Basket