Recombinant Human HMG20A, His-tagged
Cat.No. : | HMG20A-29330TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 131-347 of Human HMG20A with an N terminal His tag. Predicted mwt: 27 kDa; |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 131-347 a.a. |
Description : | High mobility group protein 20A is a protein that in humans is encoded by the HMG20A gene. |
Conjugation : | HIS |
Form : | Lyophilised:Reconstitute with 47 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | PEITRMLGNEWSKLPPEEKQRYLDEADRDKERYMKELEQY QKTEAYKVFSRKTQDRQKGKSHRQDAARQATHDHEKET EVKERSVFDIPIFTEEFLNHSKAREAELRQLRKSNMEFEERNAALQKHVESMRTAVEKLEVDVIQERSRNTVLQQHLE TLRQVLTSSFASMPLPGSGETPTVDTIDSYMNRLHSII LANPQDNENFIATVREVVNRLDR |
Gene Name | HMG20A high mobility group 20A [ Homo sapiens ] |
Official Symbol | HMG20A |
Synonyms | HMG20A; high mobility group 20A; high mobility group protein 20A; FLJ10739; HMG box domain containing 1; HMGX1; HMGXB1; |
Gene ID | 10363 |
mRNA Refseq | NM_018200 |
Protein Refseq | NP_060670 |
MIM | 605534 |
Uniprot ID | Q9NP66 |
Chromosome Location | 15q24 |
Function | DNA binding; protein binding; sequence-specific DNA binding transcription factor activity; |
◆ Recombinant Proteins | ||
HMG20A-2249C | Recombinant Chicken HMG20A | +Inquiry |
HMG20A-6565H | Recombinant Human HMG20A Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
HMG20A-2106R | Recombinant Rhesus monkey HMG20A Protein, His-tagged | +Inquiry |
Hmg20a-3411M | Recombinant Mouse Hmg20a Protein, Myc/DDK-tagged | +Inquiry |
HMG20A-29330TH | Recombinant Human HMG20A, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HMG20A-5482HCL | Recombinant Human HMG20A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HMG20A Products
Required fields are marked with *
My Review for All HMG20A Products
Required fields are marked with *