Recombinant Human HMGA1 Protein, GST-tagged
Cat.No. : | HMGA1-4863H |
Product Overview : | Human HMGA1 full-length ORF ( AAH04924.1, 1 a.a. - 96 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a non-histone protein involved in many cellular processes, including regulation of inducible gene transcription, integration of retroviruses into chromosomes, and the metastatic progression of cancer cells. The encoded protein preferentially binds to the minor groove of A+T-rich regions in double-stranded DNA. It has little secondary structure in solution but assumes distinct conformations when bound to substrates such as DNA or other proteins. The encoded protein is frequently acetylated and is found in the nucleus. At least seven transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq |
Molecular Mass : | 36.19 kDa |
AA Sequence : | MSESSSKSSQPLASKQEKDGTEKRGRGRPRKQPPKEPSEVPTPKRPRGRPKGSKNKGAAKTRKTTTTPGRKPRGRPKKLEKEEEEGISQESSEEEQ |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | HMGA1 high mobility group AT-hook 1 [ Homo sapiens ] |
Official Symbol | HMGA1 |
Synonyms | HMGA1; high mobility group AT-hook 1; high mobility group (nonhistone chromosomal) protein isoforms I and Y , HMGIY; high mobility group protein HMG-I/HMG-Y; HMG-I(Y); high mobility group protein R; high mobility group protein A1; nonhistone chromosomal high-mobility group protein HMG-I/HMG-Y; high-mobility group (nonhistone chromosomal) protein isoforms I and Y; HMG-R; HMGIY; HMGA1A; MGC4242; MGC4854; MGC12816; |
Gene ID | 3159 |
mRNA Refseq | NM_002131 |
Protein Refseq | NP_002122 |
MIM | 600701 |
UniProt ID | P17096 |
◆ Recombinant Proteins | ||
HMGA1-7725M | Recombinant Mouse HMGA1 Protein | +Inquiry |
HMGA1-2865R | Recombinant Rat HMGA1 Protein | +Inquiry |
Hmga1-174M | Recombinant Mouse Hmga1 Protein, His-tagged | +Inquiry |
Hmga1-175R | Recombinant Rat Hmga1 Protein, His-tagged | +Inquiry |
HMGA1-4863H | Recombinant Human HMGA1 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HMGA1-5479HCL | Recombinant Human HMGA1 293 Cell Lysate | +Inquiry |
HMGA1-5480HCL | Recombinant Human HMGA1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HMGA1 Products
Required fields are marked with *
My Review for All HMGA1 Products
Required fields are marked with *
0
Inquiry Basket