"HMGA1" Related Products

Expand
Expand

Recombinant Human HMGA1 Protein, His-tagged

Cat.No.: HMGA1-4435H
Product Overview: Recombinant Human HMGA1 Protein (1-96aa) was expressed in E. coli with His tag.
Source: E. coli
Species: Human
Tag : His
Form: Liquid
AA Sequence: MSESSSKSSQPLASKQEKDGTEKRGRGRPRKQPPKEPSEVPTPKRPRGRPKGSKNKGAAKTRKTTTTPGRKPRGRPKKLEKEEEEGISQESSEEEQ
Storage: Aliquot and store at -20 centigrade to -80 centigrade for up to 6 months. Avoid freeze thaw cycles.
Storage Buffer: The purified protein was resolved in 1M PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.) added with 300mM Imidazole and 15% glycerol.
Gene Name: HMGA1 high mobility group AT-hook 1 [ Homo sapiens ]
Official Symbol: HMGA1
Synonyms: HMGA1; high mobility group AT-hook 1; high mobility group (nonhistone chromosomal) protein isoforms I and Y , HMGIY; high mobility group protein HMG-I/HMG-Y; HMG-I(Y); high mobility group protein R; high mobility group protein A1; nonhistone chromosomal high-mobility group protein HMG-I/HMG-Y; high-mobility group (nonhistone chromosomal) protein isoforms I and Y; HMG-R; HMGIY; HMGA1A; MGC4242; MGC4854; MGC12816;
Gene ID: 3159
mRNA Refseq: NM_002131
Protein Refseq: NP_002122
MIM: 600701
UniProt ID: P17096

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.