Recombinant Human HMGA1 Protein, His-tagged
| Cat.No. : | HMGA1-4435H |
| Product Overview : | Recombinant Human HMGA1 Protein (1-96aa) was expressed in E. coli with His tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-96 a.a. |
| Form : | Liquid |
| AA Sequence : | MSESSSKSSQPLASKQEKDGTEKRGRGRPRKQPPKEPSEVPTPKRPRGRPKGSKNKGAAKTRKTTTTPGRKPRGRPKKLEKEEEEGISQESSEEEQ |
| Storage : | Aliquot and store at -20 centigrade to -80 centigrade for up to 6 months. Avoid freeze thaw cycles. |
| Storage Buffer : | The purified protein was resolved in 1M PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.) added with 300mM Imidazole and 15% glycerol. |
| Gene Name | HMGA1 high mobility group AT-hook 1 [ Homo sapiens ] |
| Official Symbol | HMGA1 |
| Synonyms | HMGA1; high mobility group AT-hook 1; high mobility group (nonhistone chromosomal) protein isoforms I and Y , HMGIY; high mobility group protein HMG-I/HMG-Y; HMG-I(Y); high mobility group protein R; high mobility group protein A1; nonhistone chromosomal high-mobility group protein HMG-I/HMG-Y; high-mobility group (nonhistone chromosomal) protein isoforms I and Y; HMG-R; HMGIY; HMGA1A; MGC4242; MGC4854; MGC12816; |
| Gene ID | 3159 |
| mRNA Refseq | NM_002131 |
| Protein Refseq | NP_002122 |
| MIM | 600701 |
| UniProt ID | P17096 |
| ◆ Recombinant Proteins | ||
| HMGA1-7725M | Recombinant Mouse HMGA1 Protein | +Inquiry |
| HMGA1-4435H | Recombinant Human HMGA1 Protein, His-tagged | +Inquiry |
| HMGA1-5225H | Recombinant Human HMGA1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| HMGA1-2865R | Recombinant Rat HMGA1 Protein | +Inquiry |
| HMGA1-2520R | Recombinant Rat HMGA1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| HMGA1-5479HCL | Recombinant Human HMGA1 293 Cell Lysate | +Inquiry |
| HMGA1-5480HCL | Recombinant Human HMGA1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HMGA1 Products
Required fields are marked with *
My Review for All HMGA1 Products
Required fields are marked with *
