Recombinant Human HMGA1 Protein, His-tagged

Cat.No. : HMGA1-4435H
Product Overview : Recombinant Human HMGA1 Protein (1-96aa) was expressed in E. coli with His tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1-96 a.a.
Form : Liquid
AA Sequence : MSESSSKSSQPLASKQEKDGTEKRGRGRPRKQPPKEPSEVPTPKRPRGRPKGSKNKGAAKTRKTTTTPGRKPRGRPKKLEKEEEEGISQESSEEEQ
Storage : Aliquot and store at -20 centigrade to -80 centigrade for up to 6 months. Avoid freeze thaw cycles.
Storage Buffer : The purified protein was resolved in 1M PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.) added with 300mM Imidazole and 15% glycerol.
Gene Name HMGA1 high mobility group AT-hook 1 [ Homo sapiens ]
Official Symbol HMGA1
Synonyms HMGA1; high mobility group AT-hook 1; high mobility group (nonhistone chromosomal) protein isoforms I and Y , HMGIY; high mobility group protein HMG-I/HMG-Y; HMG-I(Y); high mobility group protein R; high mobility group protein A1; nonhistone chromosomal high-mobility group protein HMG-I/HMG-Y; high-mobility group (nonhistone chromosomal) protein isoforms I and Y; HMG-R; HMGIY; HMGA1A; MGC4242; MGC4854; MGC12816;
Gene ID 3159
mRNA Refseq NM_002131
Protein Refseq NP_002122
MIM 600701
UniProt ID P17096

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HMGA1 Products

Required fields are marked with *

My Review for All HMGA1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon