Recombinant Human HMGA1 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : HMGA1-827H
Product Overview : HMGA1 MS Standard C13 and N15-labeled recombinant protein (NP_002122) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes a chromatin-associated protein involved in the regulation of gene transcription, integration of retroviruses into chromosomes, and the metastatic progression of cancer cells. The encoded protein preferentially binds to the minor groove of AT-rich regions in double-stranded DNA. Multiple transcript variants encoding different isoforms have been found for this gene. Pseudogenes of this gene have been identified on multiple chromosomes.
Molecular Mass : 10.7 kDa
AA Sequence : MSESSSKSSQPLASKQEKDGTEKRGRGRPRKQPPKEPSEVPTPKRPRGRPKGSKNKGAAKTRKTTTTPGRKPRGRPKKLEKEEEEGISQESSEEEQTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name HMGA1 high mobility group AT-hook 1 [ Homo sapiens (human) ]
Official Symbol HMGA1
Synonyms HMGA1; high mobility group AT-hook 1; high mobility group (nonhistone chromosomal) protein isoforms I and Y, HMGIY; high mobility group protein HMG-I/HMG-Y; HMG-I(Y); high mobility group protein R; high mobility group protein A1; nonhistone chromosomal high-mobility group protein HMG-I/HMG-Y; high-mobility group (nonhistone chromosomal) protein isoforms I and Y; HMG-R; HMGIY; HMGA1A; MGC4242; MGC4854; MGC12816;
Gene ID 3159
mRNA Refseq NM_002131
Protein Refseq NP_002122
MIM 600701
UniProt ID P17096

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HMGA1 Products

Required fields are marked with *

My Review for All HMGA1 Products

Required fields are marked with *

0
cart-icon