Recombinant Human HMGA2 Protein, GST-tagged
| Cat.No. : | HMGA2-4865H |
| Product Overview : | Human HMGA2 partial ORF ( NP_003474, 1 a.a. - 92 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene encodes a protein that belongs to the non-histone chromosomal high mobility group (HMG) protein family. HMG proteins function as architectural factors and are essential components of the enhancesome. This protein contains structural DNA-binding domains and may act as a transcriptional regulating factor. Identification of the deletion, amplification, and rearrangement of this gene that are associated with myxoid liposarcoma suggests a role in adipogenesis and mesenchymal differentiation. A gene knock out study of the mouse counterpart demonstrated that this gene is involved in diet-induced obesity. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq |
| Molecular Mass : | 35.86 kDa |
| AA Sequence : | MSARGEGAGQPSTSAQGQPAAPAPQKRGRGRPRKQQQEPTGEPSPKRPRGRPKGSKNKSPSKAAQKKAEATGEKRPRGRPRKWPQQVVQKKP |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | HMGA2 high mobility group AT-hook 2 [ Homo sapiens ] |
| Official Symbol | HMGA2 |
| Synonyms | HMGA2; high mobility group AT-hook 2; high mobility group (nonhistone chromosomal) protein isoform I C , HMGIC; high mobility group protein HMGI-C; BABL; LIPO; High-mobility group protein HMGI-C; high mobility group AT-hook protein 2; high-mobility group (nonhistone chromosomal) protein isoform I-C; HMGIC; HMGI-C; STQTL9; |
| Gene ID | 8091 |
| mRNA Refseq | NM_003483 |
| Protein Refseq | NP_003474 |
| MIM | 600698 |
| UniProt ID | P52926 |
| ◆ Recombinant Proteins | ||
| HMGA2-3199H | Recombinant Human HMGA2 Protein (Met1-Asp109), N-His tagged | +Inquiry |
| HMGA2-7727M | Recombinant Mouse HMGA2 Protein | +Inquiry |
| HMGA2-11956Z | Recombinant Zebrafish HMGA2 | +Inquiry |
| Hmga2-179M | Recombinant Mouse Hmga2 Protein, His/GST-tagged | +Inquiry |
| Hmga2-1139M | Recombinant Mouse Hmga2 Protein, MYC/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| HMGA2-5478HCL | Recombinant Human HMGA2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HMGA2 Products
Required fields are marked with *
My Review for All HMGA2 Products
Required fields are marked with *
