Recombinant Human HMGA2 Protein, GST-tagged

Cat.No. : HMGA2-4865H
Product Overview : Human HMGA2 partial ORF ( NP_003474, 1 a.a. - 92 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a protein that belongs to the non-histone chromosomal high mobility group (HMG) protein family. HMG proteins function as architectural factors and are essential components of the enhancesome. This protein contains structural DNA-binding domains and may act as a transcriptional regulating factor. Identification of the deletion, amplification, and rearrangement of this gene that are associated with myxoid liposarcoma suggests a role in adipogenesis and mesenchymal differentiation. A gene knock out study of the mouse counterpart demonstrated that this gene is involved in diet-induced obesity. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq
Molecular Mass : 35.86 kDa
AA Sequence : MSARGEGAGQPSTSAQGQPAAPAPQKRGRGRPRKQQQEPTGEPSPKRPRGRPKGSKNKSPSKAAQKKAEATGEKRPRGRPRKWPQQVVQKKP
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name HMGA2 high mobility group AT-hook 2 [ Homo sapiens ]
Official Symbol HMGA2
Synonyms HMGA2; high mobility group AT-hook 2; high mobility group (nonhistone chromosomal) protein isoform I C , HMGIC; high mobility group protein HMGI-C; BABL; LIPO; High-mobility group protein HMGI-C; high mobility group AT-hook protein 2; high-mobility group (nonhistone chromosomal) protein isoform I-C; HMGIC; HMGI-C; STQTL9;
Gene ID 8091
mRNA Refseq NM_003483
Protein Refseq NP_003474
MIM 600698
UniProt ID P52926

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HMGA2 Products

Required fields are marked with *

My Review for All HMGA2 Products

Required fields are marked with *

0
cart-icon