Recombinant Human HMGA2 protein, His/GST-tagged
Cat.No. : | HMGA2-178H |
Product Overview : | Recombinant Human HMGA2 protein (Met1-Asp109) was fused to His/GST-tag at N-terminus and expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST&His |
Protein Length : | 109 |
Description : | This gene encodes a protein that belongs to the non-histone chromosomal high mobility group (HMG) protein family. HMG proteins function as architectural factors and are essential components of the enhancesome. This protein contains structural DNA-binding domains and may act as a transcriptional regulating factor. Identification of the deletion, amplification, and rearrangement of this gene that are associated with myxoid liposarcoma suggests a role in adipogenesis and mesenchymal differentiation. A gene knock out study of the mouse counterpart demonstrated that this gene is involved in diet-induced obesity. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. |
Form : | Freeze-dried powder. Buffer formulation: 20mM Tris, 150mM NaCl, pH 8.0, containing 1mM EDTA, 1mM DTT, 0.01% sarcosyl, 5% Trehalose and Proclin300. |
Molecular Mass : | 40 kDa as determined by SDS-PAGE reducing conditions. |
AA Sequence : | MSARGEGAGQPSTSAQGQPAAPAPQKRGRGRPRKQQQEPTGEPSPKRPRGRPKGSKNKSPSKAAQKKAEATGEKRPRGRPRKWPQQVVQKKPAQEETEETSSQESAEED |
Endotoxin : | <1.0 EU per 1µg (determined by the LAL method). |
Purity : | >95% |
Applications : | SDS-PAGE; WB; ELISA; IP; CoIP; Reporter Assays; Purification; Amine Reactive Labeling. |
Stability : | The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37 centigrade for 48h, and no obvious degradation and precipitation were observed. The loss rate is less than 5% within the expiration date under appropriate storage condition. |
Storage : | Avoid repeated freeze/thaw cycles. Store at 2-8 centigrade for one month. Aliquot and store at -80 centigrade for 12 months. |
Reconstitution : | Reconstitute in 20mM Tris, 150mM NaCl (pH8.0) to a concentration of 0.1-1.0 mg/mL. Do not vortex. |
Gene Name | HMGA2 |
Official Symbol | HMGA2 |
Synonyms | BABL; LIPO; HMGIC; HMGI-C; STQTL9 |
Gene ID | 8091 |
mRNA Refseq | NM_003483.4 |
Protein Refseq | NP_003474.1 |
MIM | 600698 |
UniProt ID | P52926 |
◆ Recombinant Proteins | ||
HMGA2-4236M | Recombinant Mouse HMGA2 Protein, His (Fc)-Avi-tagged | +Inquiry |
HMGA2-11956Z | Recombinant Zebrafish HMGA2 | +Inquiry |
HMGA2-13840H | Recombinant Human HMGA2, GST-tagged | +Inquiry |
HMGA2-178H | Recombinant Human HMGA2 protein, His/GST-tagged | +Inquiry |
HMGA2-7727M | Recombinant Mouse HMGA2 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
HMGA2-5478HCL | Recombinant Human HMGA2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HMGA2 Products
Required fields are marked with *
My Review for All HMGA2 Products
Required fields are marked with *
0
Inquiry Basket