Recombinant Human HMGB1 Protein, GST-tagged

Cat.No. : HMGB1-4866H
Product Overview : Human HMGB1 full-length ORF ( AAH03378.1, 1 a.a. - 215 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a protein that belongs to the High Mobility Group-box superfamily. The encoded non-histone, nuclear DNA-binding protein regulates transcription, and is involved in organization of DNA. This protein plays a role in several cellular processes, including inflammation, cell differentiation and tumor cell migration. Multiple pseudogenes of this gene have been identified. Alternative splicing results in multiple transcript variants that encode the same protein. [provided by RefSeq, Sep 2015]
Molecular Mass : 49.39 kDa
AA Sequence : MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEEDEEDEEDEEEEEDEEDEDEEEDDDDE
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name HMGB1 high mobility group box 1 [ Homo sapiens ]
Official Symbol HMGB1
Synonyms HMGB1; high mobility group box 1; high mobility group (nonhistone chromosomal) protein 1 , high mobility group box 1 , HMG1; high mobility group protein B1; Amphoterin; DKFZp686A04236; high mobility group protein 1; HMG3; SBP 1; Sulfoglucuronyl carbohydrate binding protein; HMG-1; high-mobility group box 1; high-mobility group (nonhistone chromosomal) protein 1; HMG1; SBP-1;
Gene ID 3146
mRNA Refseq NM_002128
Protein Refseq NP_002119
MIM 163905
UniProt ID P09429

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HMGB1 Products

Required fields are marked with *

My Review for All HMGB1 Products

Required fields are marked with *

0
cart-icon
0
compare icon