Recombinant Human HMGB1 protein, GST-tagged
Cat.No. : | HMGB1-5643H |
Product Overview : | Recombinant Human HMGB1 protein(P09429)(8-179aa), fused with N-terminal GST tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 8-179aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 47.2 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | KPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAE |
Gene Name | HMGB1 high mobility group box 1 [ Homo sapiens ] |
Official Symbol | HMGB1 |
Synonyms | HMGB1; high mobility group box 1; high mobility group (nonhistone chromosomal) protein 1 , high mobility group box 1 , HMG1; high mobility group protein B1; Amphoterin; DKFZp686A04236; high mobility group protein 1; HMG3; SBP 1; Sulfoglucuronyl carbohydrate binding protein; HMG-1; high-mobility group box 1; high-mobility group (nonhistone chromosomal) protein 1; HMG1; SBP-1; |
Gene ID | 3146 |
mRNA Refseq | NM_002128 |
Protein Refseq | NP_002119 |
MIM | 163905 |
UniProt ID | P09429 |
◆ Recombinant Proteins | ||
Hmgb1-18R | Active Recombinant Rat Hmgb1 protein | +Inquiry |
HMGB1-700HFL | Recombinant Full Length Human HMGB1 Protein, C-Flag-tagged | +Inquiry |
Hmgb1-293R | Recombinant Rat Hmgb1, Fc-tagged | +Inquiry |
Hmgb1-2628M | Active Recombinant Mouse Hmgb1 protein, His-tagged | +Inquiry |
HMGB1-2564H | Active Recombinant Human HMGB1 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
HMGB1-8447B | Active Native Bovine HMGB1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
HMGB1-2076HCL | Recombinant Human HMGB1 cell lysate | +Inquiry |
HMGB1-1677MCL | Recombinant Mouse HMGB1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HMGB1 Products
Required fields are marked with *
My Review for All HMGB1 Products
Required fields are marked with *
0
Inquiry Basket