Recombinant Human HMGB3 protein, His-tagged

Cat.No. : HMGB3-3010H
Product Overview : Recombinant Human HMGB3 protein(1-103 aa), fused with N-terminal His tag, was expressed in E. coli.
Availability August 21, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1-103 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
AA Sequence : MAKGDPKKPKGKMSAYAFFVQTCREEHKKKNPEVPVNFAEFSKKCSERWKTMSGKEKSKFDEMAKADKVRYDREMKDYGPAKGGKKKKDPNAPKRPPSGFFLF
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Official Symbol HMGB3
Synonyms HMGB3; high mobility group box 3; high mobility group (nonhistone chromosomal) protein 4 , high mobility group box 3 , HMG4; high mobility group protein B3; HMG2A; MGC90319; non histone chromosomal protein; high-mobility group box 3; high mobility group protein 4; high mobility group protein 2a; non-histone chromosomal protein; high-mobility group (nonhistone chromosomal) protein 4; HMG4; HMG-4; HMG-2a;
Gene ID 3149
mRNA Refseq NM_005342
Protein Refseq NP_005333
MIM 300193
UniProt ID O15347

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HMGB3 Products

Required fields are marked with *

My Review for All HMGB3 Products

Required fields are marked with *

0
cart-icon