Recombinant Human HMGB3 protein, His-tagged
| Cat.No. : | HMGB3-3010H |
| Product Overview : | Recombinant Human HMGB3 protein(1-103 aa), fused with N-terminal His tag, was expressed in E. coli. |
| Availability | February 02, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-103 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| AA Sequence : | MAKGDPKKPKGKMSAYAFFVQTCREEHKKKNPEVPVNFAEFSKKCSERWKTMSGKEKSKFDEMAKADKVRYDREMKDYGPAKGGKKKKDPNAPKRPPSGFFLF |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Official Symbol | HMGB3 |
| Synonyms | HMGB3; high mobility group box 3; high mobility group (nonhistone chromosomal) protein 4 , high mobility group box 3 , HMG4; high mobility group protein B3; HMG2A; MGC90319; non histone chromosomal protein; high-mobility group box 3; high mobility group protein 4; high mobility group protein 2a; non-histone chromosomal protein; high-mobility group (nonhistone chromosomal) protein 4; HMG4; HMG-4; HMG-2a; |
| Gene ID | 3149 |
| mRNA Refseq | NM_005342 |
| Protein Refseq | NP_005333 |
| MIM | 300193 |
| UniProt ID | O15347 |
| ◆ Recombinant Proteins | ||
| HMGB3-7730M | Recombinant Mouse HMGB3 Protein | +Inquiry |
| HMGB3-3645HF | Recombinant Full Length Human HMGB3 Protein, GST-tagged | +Inquiry |
| HMGB3-105H | Recombinant Human HMGB3, His-tagged | +Inquiry |
| Hmgb3-1627R | Recombinant Rat Hmgb3 Protein, His-tagged | +Inquiry |
| HMGB3-3356H | Recombinant Human HMGB3 Protein (Ser14-Ala176), N-His tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| HMGB3-801HCL | Recombinant Human HMGB3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HMGB3 Products
Required fields are marked with *
My Review for All HMGB3 Products
Required fields are marked with *
