Recombinant Human HMGCS1
| Cat.No. : | HMGCS1-29335TH |
| Product Overview : | Recombinant fragment of Human HMGCS1 with N terminal proprietary tag, 36.52kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 99 amino acids |
| Molecular Weight : | 36.520kDa inclusive of tags |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | VFAENMKLREDTYHLVNYIPQGSIDSLFEGTWYLVRVDEKHRRTYARRPTPNDDTLDEGVGLVHSNIATEHIPSPAKKVPRLPATAAEPEAAVISNGEH |
| Sequence Similarities : | Belongs to the HMG-CoA synthase family. |
| Gene Name | HMGCS1 3-hydroxy-3-methylglutaryl-CoA synthase 1 (soluble) [ Homo sapiens ] |
| Official Symbol | HMGCS1 |
| Synonyms | HMGCS1; 3-hydroxy-3-methylglutaryl-CoA synthase 1 (soluble); 3 hydroxy 3 methylglutaryl Coenzyme A synthase 1 (soluble) , HMGCS; hydroxymethylglutaryl-CoA synthase, cytoplasmic; 3 hydroxy 3 methylglutaryl coenzyme A (HMG CoA) synthase; |
| Gene ID | 3157 |
| mRNA Refseq | NM_001098272 |
| Protein Refseq | NP_001091742 |
| MIM | 142940 |
| Uniprot ID | Q01581 |
| Chromosome Location | 5p14-p13 |
| Pathway | Butanoate metabolism, organism-specific biosystem; Butanoate metabolism, conserved biosystem; C5 isoprenoid biosynthesis, mevalonate pathway, organism-specific biosystem; C5 isoprenoid biosynthesis, mevalonate pathway, conserved biosystem; Cholesterol Biosynthesis, organism-specific biosystem; |
| Function | catalytic activity; drug binding; hydroxymethylglutaryl-CoA synthase activity; isomerase activity; organic acid binding; |
| ◆ Recombinant Proteins | ||
| HMGCS1-29335TH | Recombinant Human HMGCS1 | +Inquiry |
| HMGCS1-2109R | Recombinant Rhesus monkey HMGCS1 Protein, His-tagged | +Inquiry |
| HMGCS1-1691M | Recombinant Mouse HMGCS1 Protein (1-520 aa), His-tagged | +Inquiry |
| HMGCS1-6503H | Recombinant Human HMGCS1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| HMGCS1-6962C | Recombinant Chicken HMGCS1 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| HMGCS1-803HCL | Recombinant Human HMGCS1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HMGCS1 Products
Required fields are marked with *
My Review for All HMGCS1 Products
Required fields are marked with *
