Recombinant Human HMGCS1 Protein, GST-tagged
Cat.No. : | HMGCS1-4876H |
Product Overview : | Human HMGCS1 partial ORF ( NP_002121, 422 a.a. - 520 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | HMGCS1 (3-Hydroxy-3-Methylglutaryl-CoA Synthase 1) is a Protein Coding gene. Among its related pathways are Bisphosphonate Pathway, Pharmacodynamics and Sterol Regulatory Element-Binding Proteins (SREBP) signalling. GO annotations related to this gene include protein homodimerization activity and isomerase activity. An important paralog of this gene is HMGCS2. |
Molecular Mass : | 36.63 kDa |
AA Sequence : | VFAENMKLREDTHHLVNYIPQGSIDSLFEGTWYLVRVDEKHRRTYARRPTPNDDTLDEGVGLVHSNIATEHIPSPAKKVPRLPATAAEPEAAVISNGEH |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | HMGCS1 3-hydroxy-3-methylglutaryl-CoA synthase 1 (soluble) [ Homo sapiens ] |
Official Symbol | HMGCS1 |
Synonyms | HMGCS1; 3-hydroxy-3-methylglutaryl-CoA synthase 1 (soluble); 3 hydroxy 3 methylglutaryl Coenzyme A synthase 1 (soluble) , HMGCS; hydroxymethylglutaryl-CoA synthase, cytoplasmic; 3 hydroxy 3 methylglutaryl coenzyme A (HMG CoA) synthase; HMG-CoA synthase; 3-hydroxy-3-methylglutaryl coenzyme A synthase; 3-hydroxy-3-methylglutaryl coenzyme A (HMG-CoA) synthase; 3-hydroxy-3-methylglutaryl-Coenzyme A synthase 1 (soluble); HMGCS; MGC90332; |
Gene ID | 3157 |
mRNA Refseq | NM_001098272 |
Protein Refseq | NP_001091742 |
MIM | 142940 |
UniProt ID | Q01581 |
◆ Recombinant Proteins | ||
HMGCS1-2109R | Recombinant Rhesus monkey HMGCS1 Protein, His-tagged | +Inquiry |
Hmgcs1-1756M | Recombinant Mouse Hmgcs1 protein, His & T7-tagged | +Inquiry |
HMGCS1-45H | Recombinant Human HMGCS1 protein, His-tagged | +Inquiry |
Hmgcs1-3414M | Recombinant Mouse Hmgcs1 Protein, Myc/DDK-tagged | +Inquiry |
HMGCS1-59H | Recombinant Human HMGCS1, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HMGCS1-803HCL | Recombinant Human HMGCS1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HMGCS1 Products
Required fields are marked with *
My Review for All HMGCS1 Products
Required fields are marked with *