Recombinant Human HMGN2 Protein, GST-tagged
Cat.No. : | HMGN2-4880H |
Product Overview : | Human HMGN2 full-length ORF ( AAH14644, 1 a.a. - 90 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene binds nucleosomal DNA and is associated with transcriptionally active chromatin. Along with a similar protein, HMGN1, the encoded protein may help maintain an open chromatin configuration around transcribable genes. The protein has also been found to have antimicrobial activity against bacteria, viruses and fungi. [provided by RefSeq, Oct 2014] |
Molecular Mass : | 35.64 kDa |
AA Sequence : | MPKRKAEEDAKGDKAKVKDEPQRRSARLSAKPAPPKPEPKPKKAPAKKGEKVPKGKKGKADAGKEGNNPAENGDAKTDQAQKAEGAGDAK |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | HMGN2 high mobility group nucleosomal binding domain 2 [ Homo sapiens ] |
Official Symbol | HMGN2 |
Synonyms | HMG17 |
Gene ID | 3151 |
mRNA Refseq | NM_005517 |
Protein Refseq | NP_005508 |
MIM | 163910 |
UniProt ID | P05204 |
◆ Recombinant Proteins | ||
HMGN2-5271P | Recombinant Pig HMGN2 protein | +Inquiry |
HMGN2-1445H | Recombinant Human HMGN2 protein, His-tagged | +Inquiry |
HMGN2-3659HF | Recombinant Full Length Human HMGN2 Protein, GST-tagged | +Inquiry |
HMGN2-4880H | Recombinant Human HMGN2 Protein, GST-tagged | +Inquiry |
HMGN2-3368H | Recombinant Human HMGN2 Protein (Pro2-Gln81), His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HMGN2-332HCL | Recombinant Human HMGN2 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HMGN2 Products
Required fields are marked with *
My Review for All HMGN2 Products
Required fields are marked with *