Recombinant Human HN1L protein, His-tagged
Cat.No. : | HN1L-13860H |
Product Overview : | Recombinant Human HN1L protein(1-190 aa), fused with His tag, was expressed in E.coli. |
Availability | June 13, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-190 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | MFQVPDSEGGRAGSRAMKPPGGESSNLFGSPEEATPSSRPNRMASNIFGPTEEPQNIPKRTNPPGGKGSGIFDESTPVQTRQHLNPPGGKTSDIFGSPVTATSRLAHPNKPKDHVFLCEGEEPKSDLKAARSIPAGAEPGEKGSARKAGPAKEQEPMPTVDSHEPRLGPRPRSHNKVLNPPGGKSSISFY |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | HN1L hematological and neurological expressed 1-like [ Homo sapiens ] |
Official Symbol | HN1L |
Synonyms | HN1L; hematological and neurological expressed 1-like; C16orf34, chromosome 16 open reading frame 34; hematological and neurological expressed 1-like protein; FLJ13092; KIAA1426; L11; HN1 like; CRAMP_1 like; HN1-like protein; C16orf34; |
Gene ID | 90861 |
mRNA Refseq | NM_144570 |
Protein Refseq | NP_653171 |
UniProt ID | Q9H910 |
◆ Recombinant Proteins | ||
HN1L-5402C | Recombinant Chicken HN1L | +Inquiry |
HN1L-7234H | Recombinant Human HN1L, His-tagged | +Inquiry |
HN1L-13860H | Recombinant Human HN1L protein, His-tagged | +Inquiry |
HN1L-2875R | Recombinant Rat HN1L Protein | +Inquiry |
HN1L-9978Z | Recombinant Zebrafish HN1L | +Inquiry |
◆ Cell & Tissue Lysates | ||
HN1L-5462HCL | Recombinant Human HN1L 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HN1L Products
Required fields are marked with *
My Review for All HN1L Products
Required fields are marked with *
0
Inquiry Basket