Recombinant Human HN1L protein, His-tagged

Cat.No. : HN1L-13860H
Product Overview : Recombinant Human HN1L protein(1-190 aa), fused with His tag, was expressed in E.coli.
Availability November 04, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1-190 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
AA Sequence : MFQVPDSEGGRAGSRAMKPPGGESSNLFGSPEEATPSSRPNRMASNIFGPTEEPQNIPKRTNPPGGKGSGIFDESTPVQTRQHLNPPGGKTSDIFGSPVTATSRLAHPNKPKDHVFLCEGEEPKSDLKAARSIPAGAEPGEKGSARKAGPAKEQEPMPTVDSHEPRLGPRPRSHNKVLNPPGGKSSISFY
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name HN1L hematological and neurological expressed 1-like [ Homo sapiens ]
Official Symbol HN1L
Synonyms HN1L; hematological and neurological expressed 1-like; C16orf34, chromosome 16 open reading frame 34; hematological and neurological expressed 1-like protein; FLJ13092; KIAA1426; L11; HN1 like; CRAMP_1 like; HN1-like protein; C16orf34;
Gene ID 90861
mRNA Refseq NM_144570
Protein Refseq NP_653171
UniProt ID Q9H910

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HN1L Products

Required fields are marked with *

My Review for All HN1L Products

Required fields are marked with *

0
cart-icon
0
compare icon