Recombinant Human HNF1A Protein, GST-tagged
Cat.No. : | HNF1A-4891H |
Product Overview : | Human HNF1A partial ORF (P20823, 532 a.a. - 631 a.a.) recombinant protein with GST tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 532-631 a.a. |
Description : | The protein encoded by this gene is a transcription factor required for the expression of several liver-specific genes. The encoded protein functions as a homodimer and binds to the inverted palindrome 5-GTTAATNATTAAC-3. Defects in this gene are a cause of maturity onset diabetes of the young type 3 (MODY3) and also can result in the appearance of hepatic adenomas. [provided by RefSeq |
Molecular Mass : | 36.63 kDa |
AA Sequence : | ALASLTPTKQVFTSDTEASSESGLHTPASQATTLHVPSQDPAGIQHLQPAHRLSASPTVSSSSLVLYQSSDSSNGQSHLLPSNHSVIETFISTQMASSSQ |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | HNF1A HNF1 homeobox A [ Homo sapiens ] |
Official Symbol | HNF1A |
Synonyms | HNF1A; HNF1 homeobox A; MODY3, TCF1, transcription factor 1, hepatic; LF B1, hepatic nuclear factor (HNF1), albumin proximal factor; hepatocyte nuclear factor 1-alpha; HNF1; LFB1; HNF-1-alpha; albumin proximal factor; hepatic nuclear factor 1; transcription factor 1, hepatic; interferon production regulator factor; liver-specific transcription factor LF-B1; TCF1; MODY3; TCF-1; HNF-1A; IDDM20; |
Gene ID | 6927 |
mRNA Refseq | NM_000545 |
Protein Refseq | NP_000536 |
MIM | 142410 |
UniProt ID | P20823 |
◆ Recombinant Proteins | ||
Hnf1a-1633M | Recombinant Mouse Hnf1a Protein, His&GST-tagged | +Inquiry |
HNF1A-4253M | Recombinant Mouse HNF1A Protein, His (Fc)-Avi-tagged | +Inquiry |
HNF1A-2531R | Recombinant Rat HNF1A Protein, His (Fc)-Avi-tagged | +Inquiry |
HNF1A-9486Z | Recombinant Zebrafish HNF1A | +Inquiry |
HNF1A-2372C | Recombinant Chicken HNF1A | +Inquiry |
◆ Cell & Tissue Lysates | ||
HNF1A-5461HCL | Recombinant Human HNF1A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HNF1A Products
Required fields are marked with *
My Review for All HNF1A Products
Required fields are marked with *