Recombinant Human HNF1B
Cat.No. : | HNF1B-29461TH |
Product Overview : | Recombinant fragment of Human TCF2 with N terminal proprietary tag; Predicted MW 37.29kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 105 amino acids |
Description : | This gene encodes a member of the homeodomain-containing superfamily of transcription factors. The protein binds to DNA as either a homodimer, or a heterodimer with the related protein hepatocyte nuclear factor 1-alpha. The gene has been shown to function in nephron development, and regulates development of the embryonic pancreas. Mutations in this gene result in renal cysts and diabetes syndrome and noninsulin-dependent diabetes mellitus, and expression of this gene is altered in some types of cancer. Multiple transcript variants encoding different isoforms have been found for this gene. |
Molecular Weight : | 37.290kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | VRKQREILRQFNQTVQSSGNMTDKSSQDQLLFLFPEFSQQ SHGPGQSDDACSEPTNKKMRRNRFKWGPASQQILYQAYDR QKNPSKEEREALVEECNRAECLQRG |
Sequence Similarities : | Belongs to the HNF1 homeobox family.Contains 1 homeobox DNA-binding domain. |
Gene Name | HNF1B HNF1 homeobox B [ Homo sapiens ] |
Official Symbol | HNF1B |
Synonyms | HNF1B; HNF1 homeobox B; TCF2, transcription factor 2, hepatic; LF B3; variant hepatic nuclear factor; hepatocyte nuclear factor 1-beta; HNF1beta; LFB3; MODY5; VHNF1; |
Gene ID | 6928 |
mRNA Refseq | NM_000458 |
Protein Refseq | NP_000449 |
MIM | 189907 |
Uniprot ID | P35680 |
Chromosome Location | 17q12 |
Pathway | Developmental Biology, organism-specific biosystem; Maturity onset diabetes of the young, organism-specific biosystem; Maturity onset diabetes of the young, conserved biosystem; Regulation of beta-cell development, organism-specific biosystem; Regulation of gene expression in early pancreatic precursor cells, organism-specific biosystem; |
Function | DNA binding; protein binding; protein heterodimerization activity; protein homodimerization activity; protein homodimerization activity; |
◆ Recombinant Proteins | ||
HNF1B-564H | Recombinant Human HNF1B Protein, His-tagged | +Inquiry |
HNF1B-1936R | Recombinant Rhesus Macaque HNF1B Protein, His (Fc)-Avi-tagged | +Inquiry |
HNF1B-2115R | Recombinant Rhesus monkey HNF1B Protein, His-tagged | +Inquiry |
HNF1B-7751M | Recombinant Mouse HNF1B Protein | +Inquiry |
Hnf1b-6335M | Recombinant Mouse Hnf1b Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HNF1B-5460HCL | Recombinant Human HNF1B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HNF1B Products
Required fields are marked with *
My Review for All HNF1B Products
Required fields are marked with *
0
Inquiry Basket