Recombinant Human HNF1B
| Cat.No. : | HNF1B-29461TH |
| Product Overview : | Recombinant fragment of Human TCF2 with N terminal proprietary tag; Predicted MW 37.29kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 105 amino acids |
| Description : | This gene encodes a member of the homeodomain-containing superfamily of transcription factors. The protein binds to DNA as either a homodimer, or a heterodimer with the related protein hepatocyte nuclear factor 1-alpha. The gene has been shown to function in nephron development, and regulates development of the embryonic pancreas. Mutations in this gene result in renal cysts and diabetes syndrome and noninsulin-dependent diabetes mellitus, and expression of this gene is altered in some types of cancer. Multiple transcript variants encoding different isoforms have been found for this gene. |
| Molecular Weight : | 37.290kDa inclusive of tags |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | VRKQREILRQFNQTVQSSGNMTDKSSQDQLLFLFPEFSQQ SHGPGQSDDACSEPTNKKMRRNRFKWGPASQQILYQAYDR QKNPSKEEREALVEECNRAECLQRG |
| Sequence Similarities : | Belongs to the HNF1 homeobox family.Contains 1 homeobox DNA-binding domain. |
| Gene Name | HNF1B HNF1 homeobox B [ Homo sapiens ] |
| Official Symbol | HNF1B |
| Synonyms | HNF1B; HNF1 homeobox B; TCF2, transcription factor 2, hepatic; LF B3; variant hepatic nuclear factor; hepatocyte nuclear factor 1-beta; HNF1beta; LFB3; MODY5; VHNF1; |
| Gene ID | 6928 |
| mRNA Refseq | NM_000458 |
| Protein Refseq | NP_000449 |
| MIM | 189907 |
| Uniprot ID | P35680 |
| Chromosome Location | 17q12 |
| Pathway | Developmental Biology, organism-specific biosystem; Maturity onset diabetes of the young, organism-specific biosystem; Maturity onset diabetes of the young, conserved biosystem; Regulation of beta-cell development, organism-specific biosystem; Regulation of gene expression in early pancreatic precursor cells, organism-specific biosystem; |
| Function | DNA binding; protein binding; protein heterodimerization activity; protein homodimerization activity; protein homodimerization activity; |
| ◆ Recombinant Proteins | ||
| HNF1B-13862H | Recombinant Human HNF1B, GST-tagged | +Inquiry |
| HNF1B-564H | Recombinant Human HNF1B Protein, His-tagged | +Inquiry |
| HNF1B-2532R | Recombinant Rat HNF1B Protein, His (Fc)-Avi-tagged | +Inquiry |
| HNF1B-2877R | Recombinant Rat HNF1B Protein | +Inquiry |
| HNF1B-29461TH | Recombinant Human HNF1B | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| HNF1B-5460HCL | Recombinant Human HNF1B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HNF1B Products
Required fields are marked with *
My Review for All HNF1B Products
Required fields are marked with *
