Recombinant Human HNRNPAB Protein, GST-tagged
Cat.No. : | HNRNPAB-4912H |
Product Overview : | Human HNRPAB full-length ORF ( NP_004490.2, 1 a.a. - 285 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are produced by RNA polymerase II and are components of the heterogeneous nuclear RNA (hnRNA) complexes. They are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. The protein encoded by this gene, which binds to one of the components of the multiprotein editosome complex, has two repeats of quasi-RRM (RNA recognition motif) domains that bind to RNAs. Two alternatively spliced transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq |
Molecular Mass : | 57 kDa |
AA Sequence : | MSEAGEEQPMETTGATENGHEAVPEGESPAGAGTGAAAGAGGATAAPPSGNQNGAEGDQINASKNEEDAGKMFVGGLSWDTSKKDLKDYFTKFGEVVDCTIKMDPNTGRSRGFGFILFKDAASVEKVLDQKEHRLDGRVIDPKKAMAMKKDPVKKIFVGGLNPEATEEKIREYFGEFGEIEAIELPMDPKLNKRRGFVFITFKEEEPVKKVLEKKFHTVSGSKCEIKVAQPKEVYQQQQYGSGGRGNRNRGNRGSGGGGGGGGQGSTNYGKSQRRGGHQNNYKPY |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | HNRNPAB heterogeneous nuclear ribonucleoprotein A/B [ Homo sapiens ] |
Official Symbol | HNRNPAB |
Synonyms | ABBP1; HNRPAB |
Gene ID | 3182 |
mRNA Refseq | NM_031266 |
Protein Refseq | NP_112556 |
MIM | 602688 |
UniProt ID | Q99729 |
◆ Recombinant Proteins | ||
HNRNPAB-2284H | Recombinant Human HNRNPAB Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
HNRNPAB-288H | Recombinant Human heterogeneous nuclear ribonucleoprotein A/B, His-tagged | +Inquiry |
HNRNPAB-59H | Recombinant Human HNRNPAB protein, His-tagged | +Inquiry |
HNRNPAB-6880C | Recombinant Chicken HNRNPAB | +Inquiry |
HNRNPAB-3675HF | Recombinant Full Length Human HNRNPAB Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HNRNPAB-5450HCL | Recombinant Human HNRNPAB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HNRNPAB Products
Required fields are marked with *
My Review for All HNRNPAB Products
Required fields are marked with *