Recombinant Human HNRNPH1 Protein (2-216 aa), GST-tagged

Cat.No. : HNRNPH1-1202H
Product Overview : Recombinant Human HNRNPH1 Protein (2-216 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Research Area: Transcription. Protein Description: Partial.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 2-216 aa
Description : This protein is a component of the heterogeneous nuclear ribonucleoprotein (hnRNP) complexes which provide the substrate for the processing events that pre-mRNAs undergo before becoming functional, translatable mRNAs in the cytoplasm. Mediates pre-mRNA alternative splicing regulation. Inhibits, together with CUGBP1, insulin receptor (IR) pre-mRNA exon 11 inclusion in myoblast. Binds to the IR RNA. Binds poly(RG).
Form : Tris-based buffer,50% glycerol
Molecular Mass : 51.2 kDa
AA Sequence : MLGTEGGEGFVVKVRGLPWSCSADEVQRFFSDCKIQNGAQGIRFIYTREGRPSGEAFVELESEDEVKLALKKDRETMGHRYVEVFKSNNVEMDWVLKHTGPNSPDTANDGFVRLRGLPFGCSKEEIVQFFSGLEIVPNGITLPVDFQGRSTGEAFVQFASQEIAEKALKKHKERIGHRYIEIFKSSRAEVRTHYDPPRKLMAMQRPGPYDRPGAG
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with reconstitution instruction is sent along with the products. Please refer to it for detailed information.
Gene Name HNRNPH1 heterogeneous nuclear ribonucleoprotein H1 (H) [ Homo sapiens ]
Official Symbol HNRNPH1
Synonyms HNRNPH1; HNRPH1; hnRNPH; HNRPH; DKFZp686A15170;
Gene ID 3187
mRNA Refseq NM_001257293
Protein Refseq NP_001244222
MIM 601035
UniProt ID P31943

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HNRNPH1 Products

Required fields are marked with *

My Review for All HNRNPH1 Products

Required fields are marked with *

0
cart-icon
0
compare icon