Recombinant Human HNRNPH1 Protein (2-216 aa), GST-tagged
Cat.No. : | HNRNPH1-1202H |
Product Overview : | Recombinant Human HNRNPH1 Protein (2-216 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Research Area: Transcription. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 2-216 aa |
Description : | This protein is a component of the heterogeneous nuclear ribonucleoprotein (hnRNP) complexes which provide the substrate for the processing events that pre-mRNAs undergo before becoming functional, translatable mRNAs in the cytoplasm. Mediates pre-mRNA alternative splicing regulation. Inhibits, together with CUGBP1, insulin receptor (IR) pre-mRNA exon 11 inclusion in myoblast. Binds to the IR RNA. Binds poly(RG). |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 51.2 kDa |
AA Sequence : | MLGTEGGEGFVVKVRGLPWSCSADEVQRFFSDCKIQNGAQGIRFIYTREGRPSGEAFVELESEDEVKLALKKDRETMGHRYVEVFKSNNVEMDWVLKHTGPNSPDTANDGFVRLRGLPFGCSKEEIVQFFSGLEIVPNGITLPVDFQGRSTGEAFVQFASQEIAEKALKKHKERIGHRYIEIFKSSRAEVRTHYDPPRKLMAMQRPGPYDRPGAG |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. Please refer to it for detailed information. |
Gene Name | HNRNPH1 heterogeneous nuclear ribonucleoprotein H1 (H) [ Homo sapiens ] |
Official Symbol | HNRNPH1 |
Synonyms | HNRNPH1; HNRPH1; hnRNPH; HNRPH; DKFZp686A15170; |
Gene ID | 3187 |
mRNA Refseq | NM_001257293 |
Protein Refseq | NP_001244222 |
MIM | 601035 |
UniProt ID | P31943 |
◆ Recombinant Proteins | ||
HNRNPH1-1433H | Recombinant Human HNRNPH1 protein, His/SUMO-tagged | +Inquiry |
HNRNPH1-1088H | Recombinant Full Length Human HNRNPH1 Protein, His-tagged | +Inquiry |
HNRNPH1-2722H | Recombinant Human HNRNPH1 protein(11-280 aa), C-His-tagged | +Inquiry |
HNRPH1-2886R | Recombinant Rat HNRPH1 Protein | +Inquiry |
HNRNPH1-01H | Recombinant Human HNRNPH1 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HNRNPH1-5446HCL | Recombinant Human HNRNPH1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HNRNPH1 Products
Required fields are marked with *
My Review for All HNRNPH1 Products
Required fields are marked with *
0
Inquiry Basket