Recombinant Human HNRNPH1 protein, His/SUMO-tagged

Cat.No. : HNRNPH1-1433H
Product Overview : Recombinant Human HNRNPH1(2-449aa) fused with His/SUMO tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&SUMO
Protein Length : 2-449aa
Description : This gene belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. This protein has three repeats of quasi-RRM domains that bind to RNAs. It is very similar to the family member HNRPF. This gene is thought to be potentially involved in hereditary lymphedema type I phenotype.
Molecular Mass : 65.1kD
AA Sequence : MLGTEGGEGFVVKVRGLPWSCSADEVQRFFSDCKIQNGAQGIRFIYTREGRPSGEAFVELESEDEVKLALKKDRE TMGHRYVEVFKSNNVEMDWVLKHTGPNSPDTANDGFVRLRGLPFGCSKEEIVQFFSGLEIVPNGITLPVDFQGRS TGEAFVQFASQEIAEKALKKHKERIGHRYIEIFKSSRAEVRTHYDPPRKLMAMQRPGPYDRPGAGRGYNSIGRGA GFERMRRGAYGGGYGGYDDYNGYNDGYGFGSDRFGRDLNYCFSGMSDHRYGDGGSTFQSTTGHCVHMRGLPYRAT ENDIYNFFSPLNPVRVHIEIGPDGRVTGEADVEFATHEDAVAAMSKDKANMQHRYVELFLNSTAGASGGAYEHRY VELFLNSTAGASGGAYGSQMMGGMGLSNQSSYGGPASQQLSGGYGGGYGGQSSMSGYDQVLQENSSDFQSNIA
Gene Name HNRNPH1 heterogeneous nuclear ribonucleoprotein H1 (H) [ Homo sapiens ]
Official Symbol HNRNPH1
Synonyms HNRNPH1; heterogeneous nuclear ribonucleoprotein H1 (H); HNRPH1; heterogeneous nuclear ribonucleoprotein H; hnRNPH; HNRPH; DKFZp686A15170;
Gene ID 3187
mRNA Refseq NM_001257293
Protein Refseq NP_001244222
MIM 601035
UniProt ID P31943
Chromosome Location 5q35.3
Pathway Gene expression, organism-specific biosystem; Processing of Capped Intron-Containing Pre-mRNA, organism-specific biosystem; mRNA Splicing, organism-specific biosystem; mRNA Splicing - Major Pathway, organism-specific biosystem; mRNA processing, organism-specific biosystem;
Function RNA binding; nucleotide binding; poly(U) RNA binding; protein binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HNRNPH1 Products

Required fields are marked with *

My Review for All HNRNPH1 Products

Required fields are marked with *

0
cart-icon
0
compare icon