Recombinant Human HNRNPH1 protein, His/SUMO-tagged
Cat.No. : | HNRNPH1-1433H |
Product Overview : | Recombinant Human HNRNPH1(2-449aa) fused with His/SUMO tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 2-449aa |
Description : | This gene belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. This protein has three repeats of quasi-RRM domains that bind to RNAs. It is very similar to the family member HNRPF. This gene is thought to be potentially involved in hereditary lymphedema type I phenotype. |
Molecular Mass : | 65.1kD |
AA Sequence : | MLGTEGGEGFVVKVRGLPWSCSADEVQRFFSDCKIQNGAQGIRFIYTREGRPSGEAFVELESEDEVKLALKKDRE TMGHRYVEVFKSNNVEMDWVLKHTGPNSPDTANDGFVRLRGLPFGCSKEEIVQFFSGLEIVPNGITLPVDFQGRS TGEAFVQFASQEIAEKALKKHKERIGHRYIEIFKSSRAEVRTHYDPPRKLMAMQRPGPYDRPGAGRGYNSIGRGA GFERMRRGAYGGGYGGYDDYNGYNDGYGFGSDRFGRDLNYCFSGMSDHRYGDGGSTFQSTTGHCVHMRGLPYRAT ENDIYNFFSPLNPVRVHIEIGPDGRVTGEADVEFATHEDAVAAMSKDKANMQHRYVELFLNSTAGASGGAYEHRY VELFLNSTAGASGGAYGSQMMGGMGLSNQSSYGGPASQQLSGGYGGGYGGQSSMSGYDQVLQENSSDFQSNIA |
Gene Name | HNRNPH1 heterogeneous nuclear ribonucleoprotein H1 (H) [ Homo sapiens ] |
Official Symbol | HNRNPH1 |
Synonyms | HNRNPH1; heterogeneous nuclear ribonucleoprotein H1 (H); HNRPH1; heterogeneous nuclear ribonucleoprotein H; hnRNPH; HNRPH; DKFZp686A15170; |
Gene ID | 3187 |
mRNA Refseq | NM_001257293 |
Protein Refseq | NP_001244222 |
MIM | 601035 |
UniProt ID | P31943 |
Chromosome Location | 5q35.3 |
Pathway | Gene ex |
Function | RNA binding; nucleotide binding; poly(U) RNA binding; protein binding; |
◆ Recombinant Proteins | ||
HNRNPH1-40H | Recombinant Human HNRNPH1 Protein, His-tagged | +Inquiry |
HNRNPH1-13871H | Recombinant Human HNRNPH1, His-tagged | +Inquiry |
HNRNPH1-6066C | Recombinant Chicken HNRNPH1 | +Inquiry |
HNRNPH1-01H | Recombinant Human HNRNPH1 Protein, His-tagged | +Inquiry |
HNRNPH1-4262M | Recombinant Mouse HNRNPH1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HNRNPH1-5446HCL | Recombinant Human HNRNPH1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HNRNPH1 Products
Required fields are marked with *
My Review for All HNRNPH1 Products
Required fields are marked with *
0
Inquiry Basket