Recombinant Human HNRNPL Protein (89-335 aa), His-tagged
| Cat.No. : | HNRNPL-1414H |
| Product Overview : | Recombinant Human HNRNPL Protein (89-335 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Epigenetics and Nuclear Signaling. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Yeast |
| Tag : | His |
| Protein Length : | 89-335 aa |
| Form : | Tris-based buffer,50% glycerol |
| Molecular Mass : | 29.0 kDa |
| AA Sequence : | IRGLIDGVVEADLVEALQEFGPISYVVVMPKKRQALVEFEDVLGACNAVNYAADNQIYIAGHPAFVNYSTSQKISRPGDSDDSRSVNSVLLFTILNPIYSITTDVLYTICNPCGPVQRIVIFRKNGVQAMVEFDSVQSAQRAKASLNGADIYSGCCTLKIEYAKPTRLNVFKNDQDTWDYTNPNLSGQGDPGSNPNKRQRQPPLLGDHPAEYGGPHGGYHSHYHDEGYGPPPPHYEGRRMGPPVGGH |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
| Gene Name | HNRNPL heterogeneous nuclear ribonucleoprotein L [ Homo sapiens ] |
| Official Symbol | HNRNPL |
| Synonyms | HNRNPL; HNRPL; hnRNP L; hnRNP-L; P/OKcl.14; FLJ35509; |
| Gene ID | 3191 |
| mRNA Refseq | NM_001005335 |
| Protein Refseq | NP_001005335 |
| MIM | 603083 |
| UniProt ID | Q6NTA2 |
| ◆ Recombinant Proteins | ||
| HNRNPL-3616HF | Recombinant Full Length Human HNRNPL Protein, GST-tagged | +Inquiry |
| HNRNPL-2127R | Recombinant Rhesus monkey HNRNPL Protein, His-tagged | +Inquiry |
| HNRNPL-1948R | Recombinant Rhesus Macaque HNRNPL Protein, His (Fc)-Avi-tagged | +Inquiry |
| HNRNPL-5744H | Recombinant Human HNRNPL protein, GST-tagged | +Inquiry |
| HNRNPL-558H | Recombinant Human HNRNPL Protein (89-335 aa), His-SUMO-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| HNRNPL-5441HCL | Recombinant Human HNRNPL 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HNRNPL Products
Required fields are marked with *
My Review for All HNRNPL Products
Required fields are marked with *
