Recombinant Human HNRNPL Protein (89-335 aa), His-SUMO-tagged
Cat.No. : | HNRNPL-558H |
Product Overview : | Recombinant Human HNRNPL Protein (89-335 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Epigenetics and Nuclear Signaling. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 89-335 aa |
Description : | Splicing factor binding to exonic or intronic sites and acting as either an activator or repressor of exon inclusion. Exhibits a binding preference for CA-rich elents. Component of the heterogeneous nuclear ribonucleoprotein (hnRNP) complexes and associated with most nascent transcripts. Associates, together with APEX1, to the negative calcium responsive elent (nCaRE) B2 of the APEX2 promoter. |
Form : | Tris-based buffer, 50% glycerol |
Molecular Mass : | 43.1 kDa |
AA Sequence : | GENYDDPHKTPASPVVHIRGLIDGVVEADLVEALQEFGPISYVVVMPKKRQALVEFEDVLGACNAVNYAADNQIYIAGHPAFVNYSTSQKISRPGDSDDSRSVNSVLLFTILNPIYSITTDVLYTICNPCGPVQRIVIFRKNGVQAMVEFDSVQSAQRAKASLNGADIYSGCCTLKIEYAKPTRLNVFKNDQDTWDYTNPNLSGQGDPGSNPNKRQRQPPLLGDHPAEYGGPHGGYHSHYHDEGYGP |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
Gene Name | HNRNPL heterogeneous nuclear ribonucleoprotein L [ Homo sapiens ] |
Official Symbol | HNRNPL |
Synonyms | HNRNPL; HNRPL; hnRNP L; hnRNP-L; P/OKcl.14; FLJ35509; |
Gene ID | 3191 |
mRNA Refseq | NM_001005335 |
Protein Refseq | NP_001005335 |
MIM | 603083 |
UniProt ID | P14866 |
◆ Recombinant Proteins | ||
HNRNPL-559H | Recombinant Human HNRNPL Protein (1-589 aa), His-SUMO-tagged | +Inquiry |
HNRNPL-2127R | Recombinant Rhesus monkey HNRNPL Protein, His-tagged | +Inquiry |
HNRNPL-1948R | Recombinant Rhesus Macaque HNRNPL Protein, His (Fc)-Avi-tagged | +Inquiry |
HNRNPL-3616HF | Recombinant Full Length Human HNRNPL Protein, GST-tagged | +Inquiry |
HNRNPL-4905H | Recombinant Human HNRNPL Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HNRNPL-5441HCL | Recombinant Human HNRNPL 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HNRNPL Products
Required fields are marked with *
My Review for All HNRNPL Products
Required fields are marked with *
0
Inquiry Basket