Recombinant Human HNRNPL Protein (89-335 aa), His-SUMO-tagged

Cat.No. : HNRNPL-558H
Product Overview : Recombinant Human HNRNPL Protein (89-335 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Epigenetics and Nuclear Signaling. Protein Description: Partial.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&SUMO
Protein Length : 89-335 aa
Description : Splicing factor binding to exonic or intronic sites and acting as either an activator or repressor of exon inclusion. Exhibits a binding preference for CA-rich elents. Component of the heterogeneous nuclear ribonucleoprotein (hnRNP) complexes and associated with most nascent transcripts. Associates, together with APEX1, to the negative calcium responsive elent (nCaRE) B2 of the APEX2 promoter.
Form : Tris-based buffer, 50% glycerol
Molecular Mass : 43.1 kDa
AA Sequence : GENYDDPHKTPASPVVHIRGLIDGVVEADLVEALQEFGPISYVVVMPKKRQALVEFEDVLGACNAVNYAADNQIYIAGHPAFVNYSTSQKISRPGDSDDSRSVNSVLLFTILNPIYSITTDVLYTICNPCGPVQRIVIFRKNGVQAMVEFDSVQSAQRAKASLNGADIYSGCCTLKIEYAKPTRLNVFKNDQDTWDYTNPNLSGQGDPGSNPNKRQRQPPLLGDHPAEYGGPHGGYHSHYHDEGYGP
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with concentration instruction is sent along with the products.
Gene Name HNRNPL heterogeneous nuclear ribonucleoprotein L [ Homo sapiens ]
Official Symbol HNRNPL
Synonyms HNRNPL; HNRPL; hnRNP L; hnRNP-L; P/OKcl.14; FLJ35509;
Gene ID 3191
mRNA Refseq NM_001005335
Protein Refseq NP_001005335
MIM 603083
UniProt ID P14866

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HNRNPL Products

Required fields are marked with *

My Review for All HNRNPL Products

Required fields are marked with *

0

Inquiry Basket

cartIcon