Recombinant Human HNRPDL Protein, GST-tagged
| Cat.No. : | HNRPDL-4915H |
| Product Overview : | Human HNRPDL full-length ORF (AAH11714.1, 1 a.a. - 420 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. The protein encoded by this gene has two RRM domains that bind to RNAs. Two alternatively spliced transcript variants have been described for this gene. One of the variants is probably not translated because the transcript is a candidate for nonsense-mediated mRNA decay. The protein encoded by this gene is similar to its family member HNRPD. [provided by RefSeq |
| Molecular Mass : | 72.8 kDa |
| AA Sequence : | MEVPPRLSHVPPPLFPSAPATLASRSLSHWRPRPPRQLAPLLPSLAPSSARQGARRAQRHVTAQQPSRLAGGAAIKGGRRRRPDLFRRHFKSSSIQRSAAAAAATRTARQHPPADSSVTMEDMNEYSNIEEFAEGSKINASKNQQDDGKMFIGGLSWDTSKKDLTEYLSRFGEVVDCTIKTDPVTGRSRGFGFVLFKDAASVDKVLELKEHKLDGKLIDPKRAKALKGKEPPKKVFVGGLSPDTSEEQIKEYFGAFGEIENIELPMDTKTNERRGFCFITYTDEEPVKKLLESRYHQIGSGKCEIKVAQPKEVYRQQQQQQKGGRGAAAGGRGGTRGRGRGQGQNWNQGFNNYYDQGYGNYNSAYGGDQNYSGYGGYDYTGYNYGNYGYGQGYADYSGQQSTYGKASRGGGNHQNNYQPY |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | HNRPDL heterogeneous nuclear ribonucleoprotein D-like [ Homo sapiens ] |
| Official Symbol | HNRPDL |
| Synonyms | heterogeneous nuclear ribonucleoprotein D-like; 5037; Ensembl:ENSG00000152795; heterogeneous nuclear ribonucleoprotein D-like;hnRNP DL;hnRNP D-like;protein laAUF1;JKT41-binding protein;AU-rich element RNA-binding factor;A+U-rich element RNA binding factor; HNRNP; JKTBP; JKTBP2; laAUF1 |
| Gene ID | 9987 |
| mRNA Refseq | NM_001207000 |
| Protein Refseq | NP_001193929 |
| MIM | 607137 |
| UniProt ID | O14979 |
| ◆ Recombinant Proteins | ||
| HNRPDL-1949R | Recombinant Rhesus Macaque HNRPDL Protein, His (Fc)-Avi-tagged | +Inquiry |
| HNRPDL-4915H | Recombinant Human HNRPDL Protein, GST-tagged | +Inquiry |
| HNRPDL-13878H | Recombinant Human HNRPDL, GST-tagged | +Inquiry |
| HNRPDL-3682HF | Recombinant Full Length Human HNRPDL Protein, GST-tagged | +Inquiry |
| HNRPDL-2128R | Recombinant Rhesus monkey HNRPDL Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HNRPDL Products
Required fields are marked with *
My Review for All HNRPDL Products
Required fields are marked with *
