Recombinant Human HOATZ Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | HOATZ-5872H |
Product Overview : | C11orf88 MS Standard C13 and N15-labeled recombinant protein (NP_997313) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | HOATZ (HOATZ Cilia And Flagella Associated Protein) is a Protein Coding gene. Diseases associated with HOATZ include Oligoasthenoteratozoospermia. An important paralog of this gene is SELENON. |
Molecular Mass : | 22.3 kDa |
AA Sequence : | METGPSEEPSGRKESQEMCPPGLLVFAGSSEQDANLAKQFWISASMYPPSESQLVLRRDSSQRLPVARPRRSRGSENSHSSQSFHLASNKNRDIFAEALKIQESEEKVKYLQKTRSHSVTQNEVQWHDHGSLQPQLSRIQAKTREEILQLLRKQREERISKELISLPYKPKAKEHKAKKVVSESDKEDQEEVKTLDTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | HOATZ HOATZ cilia and flagella associated protein [ Homo sapiens (human) ] |
Official Symbol | HOATZ |
Synonyms | HOATZ; HOATZ cilia and flagella associated protein; C11orf88; cilia- and flagella-associated protein HOATZ; UPF0722 protein C11orf88; hypothetical gene supported by BC039505; protein Hoatz |
Gene ID | 399949 |
mRNA Refseq | NM_207430 |
Protein Refseq | NP_997313 |
UniProt ID | Q6PI97 |
◆ Recombinant Proteins | ||
HOATZ-5872H | Recombinant Human HOATZ Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Hoatz-1418M | Recombinant Mouse Hoatz Protein, Myc/DDK-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HOATZ Products
Required fields are marked with *
My Review for All HOATZ Products
Required fields are marked with *
0
Inquiry Basket