Recombinant Human HOATZ Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : HOATZ-5872H
Product Overview : C11orf88 MS Standard C13 and N15-labeled recombinant protein (NP_997313) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : HOATZ (HOATZ Cilia And Flagella Associated Protein) is a Protein Coding gene. Diseases associated with HOATZ include Oligoasthenoteratozoospermia. An important paralog of this gene is SELENON.
Molecular Mass : 22.3 kDa
AA Sequence : METGPSEEPSGRKESQEMCPPGLLVFAGSSEQDANLAKQFWISASMYPPSESQLVLRRDSSQRLPVARPRRSRGSENSHSSQSFHLASNKNRDIFAEALKIQESEEKVKYLQKTRSHSVTQNEVQWHDHGSLQPQLSRIQAKTREEILQLLRKQREERISKELISLPYKPKAKEHKAKKVVSESDKEDQEEVKTLDTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name HOATZ HOATZ cilia and flagella associated protein [ Homo sapiens (human) ]
Official Symbol HOATZ
Synonyms HOATZ; HOATZ cilia and flagella associated protein; C11orf88; cilia- and flagella-associated protein HOATZ; UPF0722 protein C11orf88; hypothetical gene supported by BC039505; protein Hoatz
Gene ID 399949
mRNA Refseq NM_207430
Protein Refseq NP_997313
UniProt ID Q6PI97

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HOATZ Products

Required fields are marked with *

My Review for All HOATZ Products

Required fields are marked with *

0
cart-icon
0
compare icon