Recombinant Human HOATZ Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: HOATZ-5872H
• Product Overview: C11orf88 MS Standard C13 and N15-labeled recombinant protein (NP_997313) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: HOATZ (HOATZ Cilia And Flagella Associated Protein) is a Protein Coding gene. Diseases associated with HOATZ include Oligoasthenoteratozoospermia. An important paralog of this gene is SELENON.
• Molecular Mass: 22.3 kDa
• AA Sequence: METGPSEEPSGRKESQEMCPPGLLVFAGSSEQDANLAKQFWISASMYPPSESQLVLRRDSSQRLPVARPRRSRGSENSHSSQSFHLASNKNRDIFAEALKIQESEEKVKYLQKTRSHSVTQNEVQWHDHGSLQPQLSRIQAKTREEILQLLRKQREERISKELISLPYKPKAKEHKAKKVVSESDKEDQEEVKTLDTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: HOATZ HOATZ cilia and flagella associated protein [ Homo sapiens (human) ]
• Official Symbol: HOATZ
• Synonyms: HOATZ; HOATZ cilia and flagella associated protein; C11orf88; cilia- and flagella-associated protein HOATZ; UPF0722 protein C11orf88; hypothetical gene supported by BC039505; protein Hoatz
• Gene ID: 399949
• mRNA Refseq: NM_207430
• Protein Refseq: NP_997313
• UniProt ID: Q6PI97