Recombinant Human HOPX Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | HOPX-5527H |
Product Overview : | HOPX MS Standard C13 and N15-labeled recombinant protein (NP_631957) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | The protein encoded by this gene is a homeodomain protein that lacks certain conserved residues required for DNA binding. It was reported that choriocarcinoma cell lines and tissues failed to express this gene, which suggested the possible involvement of this gene in malignant conversion of placental trophoblasts. Studies in mice suggest that this protein may interact with serum response factor (SRF) and modulate SRF-dependent cardiac-specific gene expression and cardiac development. Multiple alternatively spliced transcript variants have been identified for this gene. |
Molecular Mass : | 8.3 kDa |
AA Sequence : | MSAETASGPTEDQVEILEYNFNKVDKHPDSTTLCLIAAEAGLSEEETQKWFKQRLAKWRRSEGLPSECRSVIDTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | HOPX HOP homeobox [ Homo sapiens (human) ] |
Official Symbol | HOPX |
Synonyms | HOPX; HOP homeobox; homeodomain-only protein; homeobox only domain; HOP; LAGY; NECC1; OB1; SMAP31; odd homeobox 1 protein; odd homeobox protein 1; lung cancer-associated Y protein; not expressed in choriocarcinoma clone 1; not expressed in choriocarcinoma protein 1; HOD; TOTO; CAMEO; MGC20820; |
Gene ID | 84525 |
mRNA Refseq | NM_139211 |
Protein Refseq | NP_631957 |
MIM | 607275 |
UniProt ID | Q9BPY8 |
◆ Recombinant Proteins | ||
HOPX-2890R | Recombinant Rat HOPX Protein | +Inquiry |
HOPX-3700HF | Recombinant Full Length Human HOPX Protein, GST-tagged | +Inquiry |
HOPX-13885H | Recombinant Human HOPX, GST-tagged | +Inquiry |
HOPX-7782M | Recombinant Mouse HOPX Protein | +Inquiry |
HOPX-2545R | Recombinant Rat HOPX Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HOPX-5432HCL | Recombinant Human HOPX 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HOPX Products
Required fields are marked with *
My Review for All HOPX Products
Required fields are marked with *