Recombinant Human HOXA1
Cat.No. : | HOXA1-28508TH |
Product Overview : | Recombinant fragment of Human HOXA1 with N-terminal proprietary tag. Predicted MW 37.62kDa. |
- Specification
- Gene Information
- Related Products
Description : | In vertebrates, the genes encoding the class of transcription factors called homeobox genes are found in clusters named A, B, C, and D on four separate chromosomes. Expression of these proteins is spatially and temporally regulated during embryonic development. This gene is part of the A cluster on chromosome 7 and encodes a DNA-binding transcription factor which may regulate gene expression, morphogenesis, and differentiation. The encoded protein may be involved in the placement of hindbrain segments in the proper location along the anterior-posterior axis during development. Two transcript variants encoding two different isoforms have been found for this gene, with only one of the isoforms containing the homeodomain region. |
Protein length : | 109 amino acids |
Molecular Weight : | 37.620kDa inclusive of tags |
Source : | Wheat germ |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | EYPILSSGDSGTCSARAYPSDHRITTFQSCAVSANSCGGD DRFLVGRGVQIGSPHHHHHHHHHHPQPATYQTSGNLGVSY SHSSCGPSYGSQNFSAPYSPYALNQEADV |
Sequence Similarities : | Belongs to the Antp homeobox family. Labial subfamily.Contains 1 homeobox DNA-binding domain. |
Gene Name : | HOXA1 homeobox A1 [ Homo sapiens ] |
Official Symbol : | HOXA1 |
Synonyms : | HOXA1; homeobox A1; homeo box A1 , HOX1, HOX1F; homeobox protein Hox-A1; |
Gene ID : | 3198 |
mRNA Refseq : | NM_005522 |
Protein Refseq : | NP_005513 |
MIM : | 142955 |
Uniprot ID : | P49639 |
Chromosome Location : | 7p15.2 |
Function : | protein binding; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; |
Products Types
◆ Recombinant Protein | ||
HOXA1-2547R | Recombinant Rat HOXA1 Protein, His (Fc)-Avi-tagged | +Inquiry |
HOXA1-4937H | Recombinant Human HOXA1 Protein, GST-tagged | +Inquiry |
HOXA1-2892R | Recombinant Rat HOXA1 Protein | +Inquiry |
HOXA1-6949H | Recombinant Human HOXA1 protein, His-tagged | +Inquiry |
◆ Lysates | ||
HOXA1-5430HCL | Recombinant Human HOXA1 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket