Recombinant Human HOXA5 protein, His-tagged
| Cat.No. : | HOXA5-2777H |
| Product Overview : | Recombinant Human HOXA5 protein(64 - 163 aa), fused to His tag, was expressed in E. coli. |
| Availability | November 21, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 64 - 163 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | FGSGERARSYAASASAAPAEPRYSQPATSTHSPQPDPLPCSAVAPSPGSDSHHGGKNSLSNSSGASADAGSTHISSREGVGTASGAEEDAPASSEQASAQ |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | HOXA5 homeobox A5 [ Homo sapiens ] |
| Official Symbol | HOXA5 |
| Synonyms | HOXA5; homeobox A5; homeo box A5 , HOX1, HOX1C; homeobox protein Hox-A5; homeo box 1C; homeo box A5; homeobox protein HOXA5; homeobox protein Hox-1C; HOX1; HOX1C; HOX1.3; MGC9376; |
| Gene ID | 3202 |
| mRNA Refseq | NM_019102 |
| Protein Refseq | NP_061975 |
| MIM | 142952 |
| UniProt ID | P20719 |
| ◆ Recombinant Proteins | ||
| HOXA5-29376TH | Recombinant Human HOXA5 | +Inquiry |
| HOXA5-01H | Recombinant Human HOXA5 Protein, His-tagged | +Inquiry |
| HOXA5-301240H | Recombinant Human HOXA5 protein, GST-tagged | +Inquiry |
| HOXA5-3711HF | Recombinant Full Length Human HOXA5 Protein, GST-tagged | +Inquiry |
| HOXA5-2777H | Recombinant Human HOXA5 protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| HOXA5-5425HCL | Recombinant Human HOXA5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HOXA5 Products
Required fields are marked with *
My Review for All HOXA5 Products
Required fields are marked with *
