Recombinant Human HOXB3

• Cat.No.: HOXB3-28511TH
• Product Overview: Recombinant fragment of Human Hoxb3 with an N terminal proprietary tag; Predicted MWt 36.52 kDa.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 99 amino acids
• Description: This gene is a member of the Antp homeobox family and encodes a nuclear protein with a homeobox DNA-binding domain. It is included in a cluster of homeobox B genes located on chromosome 17. The encoded protein functions as a sequence-specific transcription factor that is involved in development. Increased expression of this gene is associated with a distinct biologic subset of acute myeloid leukemia (AML).
• Molecular Weight: 36.520kDa inclusive of tags
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: TAGFMNALHSMTPSYESPSPPAFGKAHQNAYALPSNYQPPLKGCGAPQKYPPTPAPEYEPHVLQANGGAYGTPTMQGSPVYVGGGGYADPLPPPAGPSL
• Sequence Similarities: Belongs to the Antp homeobox family.Contains 1 homeobox DNA-binding domain.

Gene Information

• Gene Name: HOXB3 homeobox B3 [ Homo sapiens ]
• Official Symbol: HOXB3
• Synonyms: HOXB3; homeobox B3; homeo box B3 , HOX2, HOX2G; homeobox protein Hox-B3
• Gene ID: 3213
• mRNA Refseq: NM_002146
• Protein Refseq: NP_002137
• MIM: 142966
• Uniprot ID: P14651
• Chromosome Location: 17q21.32
• Function: sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity